KEGG   Bos taurus (cow): 513497
Entry
513497            CDS       T01008                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
bta  Bos taurus (cow)
Pathway
bta01522  Endocrine resistance
bta01524  Platinum drug resistance
bta04012  ErbB signaling pathway
bta04066  HIF-1 signaling pathway
bta04068  FoxO signaling pathway
bta04110  Cell cycle
bta04115  p53 signaling pathway
bta04151  PI3K-Akt signaling pathway
bta04218  Cellular senescence
bta04630  JAK-STAT signaling pathway
bta04921  Oxytocin signaling pathway
bta04928  Parathyroid hormone synthesis, secretion and action
bta04934  Cushing syndrome
bta05160  Hepatitis C
bta05161  Hepatitis B
bta05163  Human cytomegalovirus infection
bta05165  Human papillomavirus infection
bta05166  Human T-cell leukemia virus 1 infection
bta05167  Kaposi sarcoma-associated herpesvirus infection
bta05169  Epstein-Barr virus infection
bta05200  Pathways in cancer
bta05202  Transcriptional misregulation in cancer
bta05203  Viral carcinogenesis
bta05205  Proteoglycans in cancer
bta05206  MicroRNAs in cancer
bta05210  Colorectal cancer
bta05211  Renal cell carcinoma
bta05212  Pancreatic cancer
bta05213  Endometrial cancer
bta05214  Glioma
bta05215  Prostate cancer
bta05216  Thyroid cancer
bta05217  Basal cell carcinoma
bta05218  Melanoma
bta05219  Bladder cancer
bta05220  Chronic myeloid leukemia
bta05222  Small cell lung cancer
bta05223  Non-small cell lung cancer
bta05224  Breast cancer
bta05225  Hepatocellular carcinoma
bta05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    513497 (CDKN1A)
   04630 JAK-STAT signaling pathway
    513497 (CDKN1A)
   04066 HIF-1 signaling pathway
    513497 (CDKN1A)
   04068 FoxO signaling pathway
    513497 (CDKN1A)
   04151 PI3K-Akt signaling pathway
    513497 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    513497 (CDKN1A)
   04115 p53 signaling pathway
    513497 (CDKN1A)
   04218 Cellular senescence
    513497 (CDKN1A)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    513497 (CDKN1A)
   04928 Parathyroid hormone synthesis, secretion and action
    513497 (CDKN1A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    513497 (CDKN1A)
   05202 Transcriptional misregulation in cancer
    513497 (CDKN1A)
   05206 MicroRNAs in cancer
    513497 (CDKN1A)
   05205 Proteoglycans in cancer
    513497 (CDKN1A)
   05203 Viral carcinogenesis
    513497 (CDKN1A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    513497 (CDKN1A)
   05212 Pancreatic cancer
    513497 (CDKN1A)
   05225 Hepatocellular carcinoma
    513497 (CDKN1A)
   05226 Gastric cancer
    513497 (CDKN1A)
   05214 Glioma
    513497 (CDKN1A)
   05216 Thyroid cancer
    513497 (CDKN1A)
   05220 Chronic myeloid leukemia
    513497 (CDKN1A)
   05217 Basal cell carcinoma
    513497 (CDKN1A)
   05218 Melanoma
    513497 (CDKN1A)
   05211 Renal cell carcinoma
    513497 (CDKN1A)
   05219 Bladder cancer
    513497 (CDKN1A)
   05215 Prostate cancer
    513497 (CDKN1A)
   05213 Endometrial cancer
    513497 (CDKN1A)
   05224 Breast cancer
    513497 (CDKN1A)
   05222 Small cell lung cancer
    513497 (CDKN1A)
   05223 Non-small cell lung cancer
    513497 (CDKN1A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    513497 (CDKN1A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    513497 (CDKN1A)
   05161 Hepatitis B
    513497 (CDKN1A)
   05160 Hepatitis C
    513497 (CDKN1A)
   05163 Human cytomegalovirus infection
    513497 (CDKN1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    513497 (CDKN1A)
   05169 Epstein-Barr virus infection
    513497 (CDKN1A)
   05165 Human papillomavirus infection
    513497 (CDKN1A)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    513497 (CDKN1A)
   01522 Endocrine resistance
    513497 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 513497
NCBI-ProteinID: NP_001092428
BGD-bta: BT10775
Ensembl: ENSBTAG00000008353
VGNC: 27142
UniProt: A5PKM2
LinkDB
Position
23
AA seq 161 aa
MSELSRDAHQIPRSSKACRCLFGPVDSEQLRQDCDALMASCVQEARERWNFDFVTETPLE
GDFAWERVRGLGLPKLYLPVGPRDDLGGGKRPSPSSALLQGTSQEDHLDLSLSCTLVTRS
PERPEGTPGGPGPSQGRKRRQTSMTDFYHSKRRLICSKRKP
NT seq 486 nt   +upstreamnt  +downstreamnt
atgtctgagctgtccagggacgcgcatcaaatcccccgcagcagcaaggcctgccgctgc
ctctttggtccagtggacagcgagcagctgcgccaggactgcgacgccctcatggccagc
tgcgtgcaggaggcccgagagcggtggaacttcgactttgtcaccgagacgccgctggag
ggggacttcgcctgggagcgcgtgaggggcctcggcctgcccaagctctacctgcccgtg
gggccccgagacgacctgggagggggcaagcggccgagcccctcatccgccctgctgcag
ggcacgtctcaggaggaccacttggacctgtcgctgtcctgcaccctcgtgactcgctcc
cccgagcggcccgaggggacccccggtgggcctggcccctcccagggccggaaacggcgg
cagaccagcatgacagatttctaccactccaaacgcagactgatctgctccaagaggaag
ccctaa

DBGET integrated database retrieval system