KEGG   Bos taurus (cow): 513602Help
Entry
513602            CDS       T01008                                 

Gene name
HDAC6
Definition
(RefSeq) histone deacetylase 6
  KO
K11407  histone deacetylase 6 [EC:3.5.1.98]
Organism
bta  Bos taurus (cow)
Pathway
bta05034  Alcoholism
bta05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:bta00001]
 09160 Human Diseases
  09161 Cancers: Overview
   05203 Viral carcinogenesis
    513602 (HDAC6)
  09165 Substance dependence
   05034 Alcoholism
    513602 (HDAC6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bta01009]
    513602 (HDAC6)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bta03019]
    513602 (HDAC6)
   04131 Membrane trafficking [BR:bta04131]
    513602 (HDAC6)
   03036 Chromosome and associated proteins [BR:bta03036]
    513602 (HDAC6)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     513602 (HDAC6)
Protein phosphatases and associated proteins [BR:bta01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     513602 (HDAC6)
Messenger RNA biogenesis [BR:bta03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     513602 (HDAC6)
Membrane trafficking [BR:bta04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    513602 (HDAC6)
Chromosome and associated proteins [BR:bta03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     513602 (HDAC6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl zf-UBP zf-UBP_var
Motif
Other DBs
NCBI-GeneID: 513602
NCBI-ProteinID: NP_001092430
BGD-bta: BT23879
Ensembl: ENSBTAG00000013244
VGNC: 50613
UniProt: A5PJZ7
LinkDB All DBs
Position
X
AA seq 1129 aa AA seqDB search
MTSTGQDSTTPKERRSRHNPHSPTHDSSITSKRGVKKSAILRSSPSLAEVKKKGRMKKLS
QTAEQDLIMGLQGLNLNLESRTLSGTGLVFDEQLNEFHCLWDDSFPERPERLHAIKEQLI
QEGLLDRCVSFQARFAEKEELMLVHSLEYIDLMETTQYMNEEELHVLADTYDSVYLHPNS
YTCACLASGSVLRLVDAVLEAEIRNGMAIIRPPGHHAQHSLMDGYCMFNHVAVAARYAQQ
KHDIQRVLIVDWDVHHGQGIQFAFDQDPSVLYFSIHRYEQGRFWPHLKASNWSTTGLGQG
QGYTINVPWNQVGMQDADYIAAFLHVLLPVAFEFQPQLVLVAAGFDALQGDPKGEMAATP
AGFAQLTHLLMGLAEGKLILSLEGGYNLHSLAEGVSATLHTLLGDPCPVLESPGAPCPSA
QASLSCTLEALEPFWESLVRSVESLEEKDTVEKDDVEEKEEERLPQSPELSVPIWPVLQA
RTGLVYDQQMMDHHNLWDNYHPEMPQRIHFIMHHLDELGLAKRCHSLPARPATDAELLTC
HSAEHLERLRATEKMKTRELRREGANYDSIYICSSTFACAQLAAGAACRLVEAVLAGEVL
NGVAVVRPPGHHAEPDAACGFCFFNSVAVAARHAQAISGHALRILIVDWDIHHGNGTQHI
FEEDPSVLYISLHRYDHGTFFPMGNEGACTRIGKATGTGFTVNVAWNGPRMGDADYLAAW
HRLVLPVAYEFNPELVLVSAGFDAARGDPLGGCQVSPEGYAHLTHQLMGLANGHIILILE
GGYNLTSISESMAACTRSLLGDPLPLLTRLRPPLSGAQASITKTIQVHRRYWRSLRVMKR
KNKEELSSSKLITKKPSQPASPGLANVTTTVEGNILETGMGQAASEASVKESTPDQTESA
TAPVELTQGQSSDTATQGAALDQTISEGATGGAELIQNPPASCINNRIPPALPVQGATAQ
TSPSKLMANLRILDLDSTTQEPSEEEGLLGEAAGGQDTNESVPVQVFGDHADTDEVMFYA
VRPLLWCPHLAAVCPIPETGLNVTQPCQYCGTLQENWVCLSCYQVYCGRYINAHMLQHHE
GSGHPLVLSYADLSAWCYHCQAYVHHKDLLAVKNIAHQNKFGEDIPHSD
NT seq 3390 nt NT seq  +upstreamnt  +downstreamnt
atgacctccaccggtcaggattccaccacacccaaggagcgaaggagtaggcacaatccc
cactctcccacccacgactccagcatcacctcgaagcgaggtgttaaaaagagtgccata
ctccgctccagccccagtctagcggaggtaaagaagaaaggcagaatgaagaagcttagc
caaacagccgagcaagacctaatcatggggctacaagggctgaatctgaacctggagtcc
aggacactgtctggcactggcttggtgttcgatgaacagctaaatgaattccactgcctc
tgggatgacagcttcccggaacgcccagagcggctccatgccatcaaggagcaactgatc
caggagggcctcctggaccgctgcgtgtcctttcaggcccgattcgctgaaaaggaggag
ctgatgttggttcacagcctagaatatattgatctgatggaaacgacccagtacatgaac
gaggaggagctccacgtcctagcagatacctatgactcagtttatctgcatccgaactca
tacacctgtgcctgcctggcctcaggctctgtcctcaggctggtggatgcagtcctggag
gctgagatccggaatggcatggccatcatcaggcctcctggacaccacgcccagcacagt
ctcatggatggatattgcatgttcaaccacgtggccgtggctgcccgttacgctcaacag
aagcatgatattcagagggtccttattgtggattgggatgtgcaccatggtcagggaata
cagttcgcctttgaccaagatcctagtgtcctctatttctccatccaccgctatgagcag
ggtcggttctggccccatcttaaggcctctaattggtccaccacaggtttaggccaaggc
cagggatacaccatcaatgtgccttggaaccaggtggggatgcaagatgctgactacatc
gccgctttccttcacgtcctcctgccagtcgcatttgagttccagccccagctggtcctg
gtagctgctggatttgatgccctccaaggggaccccaagggtgagatggccgccactcca
gcagggttcgcccagctcacccatctgctcatgggtctggcagaaggcaagctgatcctc
tcactggagggtggctataatctccactctctggctgaaggtgtcagcgccaccctccac
acccttctgggtgacccttgtcctgtgttagagtctcctggtgccccctgcccaagtgcc
caggcatcactctcctgtactctggaagccctggaacccttctgggagagccttgtgaga
tcagttgagagcctggaagaaaaggacactgtggagaaggatgatgtggaagagaaggag
gaagagagactgccacagtcccctgagctctccgttccgatatggccagtgctgcaggct
cgcacggggttggtctatgaccagcagatgatggaccaccacaacttgtgggataactac
caccctgagatgccccagcggatccactttatcatgcatcacctggatgaactgggcctt
gccaagcgctgccactccctacccgcaaggcccgctacagatgctgagctgctcacctgc
cacagtgctgagcacttggaacgtctacgggccacggagaagatgaagacccgggagctg
cgccgcgagggtgccaactatgactccatctacatctgctccagcacttttgcctgcgca
cagctggctgcaggcgccgcctgtcgcctggtggaggcagtactggcaggagaggtttta
aatggtgttgctgtagtgcgacctcctggccaccatgcagagccggatgcagcttgtggt
ttctgtttttttaattctgtggctgtggctgctcgccatgcccaggccatcagtgggcat
gctctgcggatcctgatcgtggactgggacatccatcatggtaatggaactcagcacata
tttgaggaggaccccagtgtgctgtacatttccctgcaccgctatgatcatggtaccttc
tttcccatggggaacgagggtgcctgtacccggataggtaaagctacaggcacaggattc
actgtcaatgtggcctggaatggaccccgcatgggtgatgctgactacctggctgcctgg
caccgtctggtgcttcctgttgcttacgagtttaacccagaactcgtgctggtctcagct
ggcttcgacgctgctcggggggatcctctgggcggctgccaggtgtcgcctgagggctat
gcccacctcacccaccagctgatgggcttggccaatggccatatcatcctaatcctagag
ggtggttataacctgacgtccatctcagagtccatggctgcctgcactcgctcccttctt
ggggatccactgcccctgctcacccggctgcggcccccactatctggagcccaggcttct
atcactaaaaccatccaagtccatcgaagatactggcgcagtttgcgggtcatgaagcgc
aaaaacaaagaggaactctccagttctaagttgatcaccaagaagccatcccaaccagcc
agtcctgggttagccaatgtgacgaccacagtggaagggaacatcctggagacaggcatg
ggacaggccgcctcagaagcatctgtgaaagagtccactccagatcagactgagtcagcg
acagctccagtagaacttactcagggccagtcctcagacacagccacacaaggagctgca
ctggaccagaccatctcagagggggccacagggggagctgaactgatccaaaaccctcca
gcctcatgcatcaacaacaggattcctcctgccttacccgtgcaaggagccacagcccag
acatcccctagtaagctgatggcaaacctcagaatactggacctagatagcacgactcag
gagccctcagaagaggaaggactactaggagaggcagctggaggtcaggacacaaatgag
tcagtgccagtgcaggtctttggagatcatgctgacactgacgaggtcatgttttatgcc
gtgagaccactgctttggtgtcctcatttggcggcagtatgccccatacctgagacaggg
ctgaatgtgacccaaccttgtcagtactgtggaacactccaggagaactgggtgtgtctg
tcttgctatcaggtctactgcggtcgttacatcaacgctcatatgctccagcaccatgaa
ggttcaggacacccactagtactcagctatgccgacctgtctgcctggtgttaccactgt
caggcctatgtccaccacaaggatctcctagcagtgaagaacatcgcccaccagaacaag
tttggggaagacataccccattcagactaa

DBGET integrated database retrieval system