KEGG   Bos taurus (cow): 513928
Entry
513928            CDS       T01008                                 

Gene name
ATF6B
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
bta  Bos taurus (cow)
Pathway
bta04022  cGMP-PKG signaling pathway
bta04141  Protein processing in endoplasmic reticulum
bta04151  PI3K-Akt signaling pathway
bta04211  Longevity regulating pathway
bta04261  Adrenergic signaling in cardiomyocytes
bta04668  TNF signaling pathway
bta04728  Dopaminergic synapse
bta04911  Insulin secretion
bta04915  Estrogen signaling pathway
bta04918  Thyroid hormone synthesis
bta04925  Aldosterone synthesis and secretion
bta04926  Relaxin signaling pathway
bta04927  Cortisol synthesis and secretion
bta04928  Parathyroid hormone synthesis, secretion and action
bta04934  Cushing syndrome
bta04935  Growth hormone synthesis, secretion and action
bta05020  Prion disease
bta05030  Cocaine addiction
bta05031  Amphetamine addiction
bta05034  Alcoholism
bta05161  Hepatitis B
bta05163  Human cytomegalovirus infection
bta05166  Human T-cell leukemia virus 1 infection
bta05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:bta00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    513928 (ATF6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    513928 (ATF6B)
   04022 cGMP-PKG signaling pathway
    513928 (ATF6B)
   04151 PI3K-Akt signaling pathway
    513928 (ATF6B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    513928 (ATF6B)
   04915 Estrogen signaling pathway
    513928 (ATF6B)
   04926 Relaxin signaling pathway
    513928 (ATF6B)
   04935 Growth hormone synthesis, secretion and action
    513928 (ATF6B)
   04918 Thyroid hormone synthesis
    513928 (ATF6B)
   04928 Parathyroid hormone synthesis, secretion and action
    513928 (ATF6B)
   04925 Aldosterone synthesis and secretion
    513928 (ATF6B)
   04927 Cortisol synthesis and secretion
    513928 (ATF6B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    513928 (ATF6B)
  09156 Nervous system
   04728 Dopaminergic synapse
    513928 (ATF6B)
  09149 Aging
   04211 Longevity regulating pathway
    513928 (ATF6B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    513928 (ATF6B)
  09164 Neurodegenerative disease
   05020 Prion disease
    513928 (ATF6B)
  09165 Substance dependence
   05030 Cocaine addiction
    513928 (ATF6B)
   05031 Amphetamine addiction
    513928 (ATF6B)
   05034 Alcoholism
    513928 (ATF6B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    513928 (ATF6B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    513928 (ATF6B)
   05161 Hepatitis B
    513928 (ATF6B)
   05163 Human cytomegalovirus infection
    513928 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bta03000]
    513928 (ATF6B)
Transcription factors [BR:bta03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    513928 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB DUF4407 GIT_CC YabA Docking
Other DBs
NCBI-GeneID: 513928
NCBI-ProteinID: NP_001077152
BGD-bta: BT10447
Ensembl: ENSBTAG00000008794
VGNC: 26245
UniProt: A4FUY2
LinkDB
Position
23
AA seq 707 aa
MAELMLLSEIADPTRFFTDNLLSPEDWDSTLYAGLDEVAEEQTELFRCPEQDVPFGSSSL
DLGMDVSPPEPPWDSLPIFPDLQVKSEPSSPCSSSSLSSESSHLSTEPSNQAPGVGEMLV
VKSESLAPPLCLLGDDPTSPFETIQINVSTISDDPSDVQIKIEPASPSSSINSEAPLLSA
ESPSQAFIGEEVLEVKTESPSPQGCLLRDVPGPSPGAVQISMGLSSDGSSGKALPARKPP
LQPKPMLITTVPIPPRAVPASTTVLLQPLVQPPPVSPVVLIQGTVRVQPEGPTPPPPRPE
RKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQGLEARLQAVLAD
NQQLRRENAALRRRLEALLTENSELKLGSGNRKVVCVMVFLLFIAFNFGPVSISEPPPAS
ISPRMSRGESRPRRHLLEFSAQEPVHGAEPRQHPFQDPEEPQPSPAGHPSFRNLTAFPGD
TRELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKTPQRAQEKQKSQFR
KKSPPVQAVPTRPPGPPEGDSVGQLQLYRQPDRSQPEFLDAIDRREDTFYVVSFRRDHLL
LPAISHNKTSRPKMSLVMPAMAPNETLSGRGPPGDYEEMMQIECEVMDTRVIHIKTSTVP
PSLRKQPSSTPGNATGGPLPASAAASQAHQAAHQPSTSIISDLYDSH
NT seq 2124 nt   +upstreamnt  +downstreamnt
atggcggagctgatgcttctcagcgagattgcggacccgacacgctttttcaccgacaac
ttgctgagcccggaggactgggacagcactttgtacgccggcttggatgaagtggccgag
gagcagacggagctcttccgttgtccggagcaagatgtcccgtttggcagcagctctctg
gacctgggaatggacgtcagccctcctgaacccccctgggactctctgcctatcttccca
gatctccaggtgaagtctgagccatcctccccctgctcttcctcctccctcagctctgaa
tcatcgcatctttccacagagccctccaaccaggcccctggtgtaggggagatgctggtt
gtgaagtcagagtccttggcacccccactctgcctcctgggagatgatccaacatcccca
tttgaaaccatccagatcaatgtcagcaccatctctgatgatccttcagatgttcagatt
aagatagagcctgcctctccatcttcctccatcaactcggaggctcccctgctctctgca
gagtcccccagccaggctttcataggagaggaggtcctggaagtgaagacagagtccccg
tcccctcaggggtgtctcctgcgggatgtccccggcccctctcctggagctgtccagatc
agcatgggcctgtcctctgacggctcctcaggcaaagccctgcctgcccggaagccacca
ctgcagcccaaacccatgctgataaccactgtcccgatacccccgagagctgtgcctgcc
agcaccaccgtcctcttgcagccccttgtccagccacccccagtgtccccagttgtcctc
atccaaggtactgttcgagtccagcctgagggaccgacccctcctcctccacggcctgag
aggaagagcattgttccagcccctatgcctgggaactcctgccctcctgaggtggatgcc
aagctgctgaagcggcagcagcggatgatcaagaaccgggagtcagcctgccagtcccgc
aggaagaagaaagagtacctgcaggggctggaagcccggctgcaagccgtgctggccgac
aaccagcagctccggcgggagaatgctgccctccgccggcggctggaggccctgctgact
gagaacagcgagctcaagttagggtctggaaacaggaaggtggtctgcgtcatggtcttc
cttctcttcatcgctttcaactttgggcctgtgagcatcagtgagcctcctccggcttcc
atctctcctcggatgagcagaggggagtctcgaccccggagacacttgctggagttctcg
gcacaagagccagttcatggagccgagccccgccagcatcccttccaggaccctgaggag
ccccagcccagccccgctggccacccaagtttcaggaacctgacagccttccctggggac
accagggagctgctgctgagagacctggaccagctcttcctctcctcggattgccggcac
tttaaccgaaccgagtccctgaggcttgctgacgagctgagtggctgggtccagcgccac
cagagaggccggcggaagacacctcagagagcccaggagaaacagaagtctcagtttcgg
aagaagtctcctccagttcaggcagtccccacccgcccccctgggcccccggaaggggat
tccgtgggccagctgcagctgtaccgccaaccagaccgttcgcagcccgagttcctggat
gcaattgaccgacgggaagacacattttacgttgtctccttccgaagggaccacttgctg
ctcccagccatcagccacaacaagacctcccggcccaagatgtctctggtgatgcctgct
atggcccccaatgagaccctgtcaggccggggaccccctggggactatgaggagatgatg
cagatcgagtgtgaggtcatggataccagggtgattcacatcaagacctccacagtgccc
ccctcgctacgaaaacagccgtcctcaaccccgggcaatgccacaggtggccccttgcca
gcttctgcagcagccagccaggctcaccaggctgcccatcagccctctacctcaatcatc
tctgacctctatgactcacactga

DBGET integrated database retrieval system