KEGG   Bos taurus (cow): 514102Help
Entry
514102            CDS       T01008                                 

Gene name
SETD1B
Definition
(RefSeq) histone-lysine N-methyltransferase SETD1B
  KO
K11422  histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
bta  Bos taurus (cow)
Pathway
bta00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    514102 (SETD1B)
Enzymes [BR:bta01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     514102 (SETD1B)
Chromosome and associated proteins [BR:bta03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     514102 (SETD1B)
   HMT complexes
    COMPASS/SET1 complex
     514102 (SETD1B)
    COMPASS/SET1 complex (yeast)
     514102 (SETD1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: N-SET SET RRM_1 RRM_5
Motif
Other DBs
NCBI-GeneID: 514102
NCBI-ProteinID: XP_024833470
BGD-bta: BT23325
Ensembl: ENSBTAG00000004172
VGNC: 50036
LinkDB All DBs
Position
17
AA seq 1966 aa AA seqDB search
MENSHPPHHHHQQPPPQPGPSGERRNHHWRSYKLMIDPALKKGHHKLYRYDGQHFSLAMS
SNRPVEIVEDPRVVGIWTKNKELELSVPKFKIDEFYVGPVPPKQVTFAKLNDNIRENFLR
DMCKKYGEVEEVEILYNPKTKKHLGIAKVVFATVRGAKEAVQHLHSTSVMGNIIHVELDT
KGETRMRFYELLVTGRYTPQTLPVGELDAVSPIVNETLQLSDALKRLKDGGLSAGCGSSS
SSVTPNSGGTPFSQDTAYSSCRLDTPNSYGQGTPLTPRLGTPFSQDSSYSSRQPTPSYLF
SQDPTTTFKARRHESKFTDAYNRRHEHHYVHNSSAVTAVAGATAAFRGAVDLPFGAVGGS
GGSSGPPFKAQPQDSATFAHTPPPTQATPAPGVAFKSAFSPYQTPVPPFPPPPEEPTTTA
PFGARDSGEFRRAPAPPPLPPAEPLTKEKPGTPPGPPPPEANSIELGGRPTFGWSPEPCD
SPGTPTLESSPAGPEKPHDSLDSRIEMLLKEQRTKLPFLREQDSDTELQMEGSPISSSSS
QLSPLAPFGANSQPGFRGPTPPSSRPSSTGLEDISPTPLPDSDEDGELDLGLGPRPPPEP
GPPDPTGLLGQTSETALDLAGDRTPTSEKMDEGQQSSGEDMEISDDEMPSAPITSADCPK
PMVVTPGAGAVAAPSVLAPTLPLPPPPGFPPLPPPPPPPPPQPGFPMPPPLPPPPPPPPP
AHPAVTVPPPPLPAPPPGVPPPPILPPLPPFPPGLFPVMQVDMSHVLGGQWGSMPMSFQM
QTQMLSRLMTGQGTCPYPPFMAAAAAAASAGLQFVNLPPYRGPFSLGNTGPGRGQPWPPL
PKFDPSVPPPGYVPRQEDPHKATVDGVLLVVLKELKAIMKRDLNRKMVEVVAFRAFDEWW
DKKERMAKASLTPVKSGEHKDEDRPKPKDRIASCLLESWGKGEGLSYEGLGLGIGLRGAI
RLPSFKVKRKEPPDTASSGDQKRLRPSTSVDEEDEESERERDRDMADAPCELAKRDPKGM
GVRRRPARPLELDSGGEEDEKESLSVSSSSSASSSSGSSTTSPSSSASDKEERESTEEEE
EGEGEEEGEEGPRSQISSSSTSSMSDKDDDDEDSDDRDESENDDEDTALSEASEKEEGDS
DGEETVSITTSKPGAESSSESSESSDFASSSESSSSSSSEDEEELPAGEDEEEEEEEGEA
AADESMAPTAPDEDFENEVVTGAPTTESQGPEEEVDIEAEDEAPKERTPMLEEPPLPVSV
EELTGCKEPPGEPGLNQEGARLLSPEPPAGEMEARPLPSPEPTPEDNLEAEPEAPALLSL
PLQPPLPPPRPPRPPSPPPEPKTPDPPLPSVPLEPPPHEEQPPRTPSLCGSLGKSQSAEA
VPATPSGEPLPTAGSGGLALSSPQLPGSPFSYPSPSPSLSSGGLPRTPGRDFSFTPTFPE
PGGPLLLPVCPLPAGRRDDRSGPLASPVLLETGLPLPLPLPLPLPLALPVPVLRAQSRAP
TQLPPLLPAPLAPCPPPIKRKPGRPRRSPPAVLTLDGPLVRPPGGAALGRDLLLLPGQPQ
TPVFPSTHDPRTVTLDFRNAGIPAPPPPLPPQPPPPPPPPPVEPTKLPFKELENQWPSEA
IPPGPRGRDEISDEFMAKVRGSWRRPPKKRHEDLVVSASPELSPPQPLFRPRSEFEEMTI
LYDIWNGGIDEEDIRFLCVTYERLLQQDNGMDWLNDTLWVYHPSTSLSSAKKKKRDDGIR
EHMTGCARSEGFYTIDKKDKLRYLNSSRASTDEPPTDTQGMSIPAQPHASTRAGSERRSE
QRRLLSSFTGSCDSDLLKFNQLKFRKKKLKFCKSHIHDWGLFAMEPIAADEMVIEYVGQN
IRQVIADMREKRYEDEGIGSSYMFRVDHDTIIDATKCGNFARFINHSCNPNCYAKVITVE
SQKKIVIYSKQHINVNEEITYDYKFPIEDVKIPCLCGSENCRGTLN
NT seq 5901 nt NT seq  +upstreamnt  +downstreamnt
atggagaacagtcaccccccccaccaccaccaccagcagcccccgccgcagcccggccct
tcgggcgagaggaggaaccaccattggagaagttacaagttgatgattgacccggctttg
aaaaaggggcatcataaactgtaccgctacgatgggcagcatttcagccttgcgatgtcc
agcaaccgcccggtggaaattgtcgaagatccccgggtggtcggcatctggacaaaaaac
aaggagctggagctgtcggtccccaaattcaagatcgatgagttctatgtgggcccggtg
cctccgaagcaggtgacatttgccaagctgaatgataacatccgtgaaaacttcctaagg
gacatgtgcaagaagtatggggaggtggaggaggtggagattttgtacaaccccaagacc
aagaagcacttgggcattgccaaagtggtctttgccacggtcaggggagccaaggaggcc
gttcagcacttgcatagcacttcggtcatgggtaatatcatccacgtggagctggacacc
aaaggggaaacccgcatgcggttctacgaactgttggtcacgggccgatacacaccccaa
accctgccagtgggtgagctggacgctgtctctccaatcgtgaatgagaccctgcagctg
tcagatgccctgaagcgcctcaaagatggtggcctgtctgcaggctgtggctccagctcg
tcctctgtcacccccaatagtggtgggacacccttctcccaggacacagcttattccagc
tgccgcttggacacacccaactcatacggccagggcacgccgctcacgccacgcctgggc
acccccttctcgcaggactcgagctattccagccgccagcccacgccctcctacctcttc
agccaggatcccacaacgaccttcaaggctcggcgccacgagagcaagttcacagatgcc
tacaaccgccgccacgagcaccattatgtccacaactcgtctgctgtcactgcagtggca
ggggccacagctgccttccggggtgcggtggacctcccattcggggcagttggcggcagt
gggggcagcagtgggcccccattcaaggcccaaccacaggattctgccacgtttgcccac
actcctccgcccacccaagcaacccctgcgcccggagtcgccttcaagtcagctttctct
ccgtatcagactcctgtgcccccttttcccccaccccctgaggagcccaccaccacagcc
ccctttggggcccgtgacagtggcgagttccgaagagcacctgcgcccccacccctgcca
cccgccgagcccctgacaaaggagaagcctggcacaccgccgggacccccgccccctgag
gccaacagcatagagctgggtggtcggccaaccttcggctggagtcctgagccttgtgac
agtcccggcacgcctacgctggagtcgtcgcccgcagggccagagaagccccatgacagc
ttagactctcggatcgagatgctgctgaaggagcagcgcaccaagctgcccttccttcgg
gagcaggactcagacacagagctgcagatggagggcagccccatctcctcctcctcctcc
cagctctccccactggccccctttggcgctaactctcagccaggctttcgaggccctaca
ccaccctcttcgcgcccctccagcactggcctggaagatatcagccccacgccactgcct
gactcagatgaggatggtgagcttgatctgggcctggggcctcggcccccacccgagccg
ggtcccccagaccctactggtcttctgggtcagacaagtgagacggccttggacctggct
ggagacaggaccccaacctcagagaagatggatgaggggcagcagtcctcaggggaggac
atggagatctcagacgacgagatgccctcggcccccatcaccagcgctgactgccccaag
cccatggtggtgaccccaggggccggggccgtggcagctccctccgtgctggccccaacc
ttgccactgcccccgccccctggcttcccaccactgcccccgcccccacccccaccccca
ccccagcccggcttccccatgcccccacctctgccaccaccaccgcccccgccacccccg
gcccatccagctgtgacagtgcccccaccacccctgccagccccgccgcctggtgtccca
cccccacccattctgccgccactgccgcccttcccaccagggctgtttcctgtgatgcag
gtggacatgagccacgtgctggggggccagtggggcagcatgcccatgtccttccagatg
caaacgcagatgctgagccgtctgatgacgggccagggcacatgcccctacccccccttc
atggctgccgcagctgcagccgcctccgccggactgcagtttgtcaacctgccgccctac
cggggccccttctcccttggtaacactggcccaggccgcgggcagccctggccacccctg
cccaagtttgacccatcagtgccaccaccaggctatgtgccccgccaggaggacccgcat
aaggccactgtggacggcgtcctgctggtggtgctcaaagagctcaaggccatcatgaag
cgggacctgaaccgcaagatggtggaggtggtggccttcagggccttcgatgagtggtgg
gacaagaaggaacggatggctaaggcctcgctgaccccagtgaagtcgggtgagcacaaa
gatgaggacaggccgaagcccaaggaccgcatcgcctcttgcctgctggagtcctggggc
aagggcgagggcctgagctacgaggggctgggcctgggcatcgggctgcgcggggccatt
cgactgccctccttcaaggtcaagaggaaggaaccgccagacacagcctcgtctggtgac
cagaagcggctgcgcccctccacctctgtggatgaggaggacgaagagtctgagcgtgag
cgggaccgggacatggccgacgccccctgtgagctcgccaagcgggaccccaagggcatg
ggcgtgcggcggcggccagcccggcccctggagctggacagcggcggggaggaggacgag
aaggagtcgctgtcggtgtcgtcttcctcgtcagcatcctcgtcctcgggctcctcgacc
acctcaccctcgtcctcagcctctgataaggaggagcgagaaagcacggaggaggaagag
gaaggggagggggaggaggagggggaggagggccccaggagccagatctcctcctcctca
acctcatccatgtcagataaggatgatgatgatgaagacagcgacgaccgggatgagtct
gagaatgatgacgaggacacagccctgtcagaggcgagtgagaaggaagaaggggactca
gatggagaggagacggtgagcatcaccacctccaagcctggagctgagtcctccagtgag
agttctgagtcatctgacttcgcatcaagctccgagtcctcttcatcatcatcctcagaa
gatgaagaagagctgccagctggggaggatgaggaagaggaggaggaggaaggggaggca
gctgcagacgagagcatggctcccactgctcctgacgaggactttgagaatgaagtcgtc
acaggagcacccacaacggagtcacagggcccagaagaggaggtggacattgaggctgag
gacgaggcccctaaggagcggaccccgatgctggaagagccccccttgcctgtgagtgtt
gaggagctgactggctgcaaggagccccccggggaaccaggcctgaaccaggaaggggcc
aggttgctgtctccagaaccccctgcaggagagatggaggcccggcccctgccatcccca
gagcctaccccagaggacaacctggaagcggagcctgaggccccggcactgctttcttta
ccgctgcagccaccattgccgccgcctcgaccgccccggccacccagcccaccaccagag
cccaagaccccagaccccccactcccatccgtccctctggagcctcccccccatgaggag
cagcccccacgtactccgagcctctgtggcagcctgggcaagtcccagagcgccgaggcg
gtgccggccacgccgagtggggagcccttgccgacggcgggcagtggcggcctggccctg
agctccccgcagctgcccggtagccccttctcctacccatccccatcccccagcttgagc
agcgggggcctcccaaggacacctggccgggacttcagcttcacacccaccttccccgag
cctgggggccccctacttctgcctgtctgccccctcccagctggccggcgtgacgatcgg
tctggccccctggcctccccggtgctcctggagacaggcttgccgcttcctttgcccttg
cccttgcccctgcccctggcgttgcccgtacctgtcctgcgggcccagtcgcgggccccc
acccagctgccccctctgctgcctgctccactggccccttgcccaccccccatcaagagg
aagccgggccggccccggcgatccccgccagctgtgctcaccttggatgggcctttggtc
cgaccgccaggaggggccgccctgggcagggacctcctgcttctgccaggccagccacag
acccctgtcttccccagcacccatgatccccggaccgtgaccctggacttccggaacgcg
gggatcccagcccctccaccacccttgcccccccagccccctccacccccacctccacca
cctgttgagcccaccaagctgccctttaaggagctagagaaccagtggccttctgaggcc
atacctccgggtccccgtgggcgtgacgagatctccgacgagttcatggccaaggtgcgg
gggtcctggcgccggccaccgaagaagcgccatgaggacctggtggtctcagcctcgccc
gagctctcgccaccgcagcctctcttccggccccgctcagagtttgaggagatgaccatc
ctctatgacatctggaatggtggcattgacgaggaggacatccgcttcctgtgtgttacc
tacgagcggctgctgcagcaggacaacggcatggactggctcaacgacacgctctgggtc
taccatccctccaccagcctctcttcagctaagaagaagaaacgggacgacggcatccgg
gagcacatgacgggctgtgcccgaagtgagggcttctataccatcgacaagaaggacaag
ctcagatacctcaacagcagtcgtgctagcaccgacgagccccccacggacacccagggc
atgagcattcccgcgcagccgcacgcctccacacgggcaggctccgagcggcgatctgag
cagcggcgcctgttgtcctccttcactggcagttgtgacagcgacctgctcaagttcaac
cagctcaagttccggaagaaaaagctcaaattctgcaagagtcacattcacgactggggc
ctgttcgccatggagcccatcgcggccgacgagatggttatcgagtatgtgggccagaac
atccgccaggtgatcgcggacatgcgggagaaacgttacgaggacgagggcatcggtagc
agctacatgttccgggtggaccacgacaccattatcgacgccaccaagtgcggcaacttc
gcgcgtttcatcaaccacagctgcaaccccaactgctacgccaaggtgatcacggtggag
tcacagaaaaagatcgtcatctattccaagcagcacatcaacgtcaatgaggagatcacc
tatgactacaagttccccatcgaggacgtcaagatcccctgcctctgtggctctgagaac
tgccgggggaccctcaactag

DBGET integrated database retrieval system