KEGG   Bos taurus (cow): 514332Help
Entry
514332            CDS       T01008                                 

Gene name
LCT
Definition
(RefSeq) lactase-phlorizin hydrolase precursor
  KO
K01229  lactase-phlorizin hydrolase [EC:3.2.1.108 3.2.1.62]
Organism
bta  Bos taurus (cow)
Pathway
bta00052  Galactose metabolism
bta01100  Metabolic pathways
bta04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    514332 (LCT)
 Organismal Systems
  Digestive system
   04973 Carbohydrate digestion and absorption
    514332 (LCT)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.62  glycosylceramidase
     514332 (LCT)
    3.2.1.108  lactase
     514332 (LCT)
Chaperones and folding catalysts [BR:bta03110]
 Intramolecular chaperones
  Others
   514332 (LCT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1
Motif
Other DBs
NCBI-GeneID: 514332
NCBI-ProteinID: NP_001192716
BGD-bta: BT25768
Ensembl: ENSBTAG00000015170
VGNC: 30819
LinkDB All DBs
Position
2
AA seq 1927 aa AA seqDB search
MELAWHLVLTVLLSFSCWGLDWDSDKNFISAAGPLTNSLLHDLRDPLGNQASPFVAEDEE
IYVCRQPLPAFLPEYFRSVRASMITHYKVFLPWAQLLPEGISENPDKETVLCYRQLLEAL
KTAQLQPLVVLHHQTLPASTLQRTETFADLFAAYASFAFHSFGDLVEIWFTFSDLERVIT
KLPHQESRSSRLQMLTDAHRKAYEIYHEKYASQGGKLSVVLRAEMLSKLLLEPSMSTLVK
DAVDFISLDLSYECHSEADLPQTLSELQTTEPKVKVFVFSLKLQNCLSTRNNVAHLLFSL
LKAINEDQMLVIGFDISTFLSCSSSSKKSWSCSLSDSLTLQTAPQLGPDTAVYAWSPRSA
YQRVWEAFANQSKAERDAFLQDVFPEGFLWGVSTGAFNVEGGWAEDGRGPSIWDRVGHQN
TNKGQATPEVASDSYHKADTDVALLRGLQAQVYKFSISWSRIFPTGQGRNPNPRGVAYYN
KLIDSLLDSHIEPMATLFHWDLPQALQDRGGWQSEDVVDAFLDYAAFCFSTFGDRVKLWV
TFHEPWVMSYAGYGTGQHAPGISDPGVASFKVAHMVLKAHARAWHHYNSHHRPQQQGRVG
IVLNSDWAEPLSPERPEDLRAAERFLHFMLGWFAHPIFVDGDYPAALRAQIQQMNKQCPS
PVAQLPEFTEAEKQLLKGSADFLGLSHYTSRLISKARGDTCIPSYDTIGGFSQHVDPTWP
QTASPWIRVVPWGIRRLLNFVSLEYTKGKVPIYLAGNGMPIGESEDLIDDSLRVDYFNQY
INEVLKAIKEDSVVVQSYIARSFIDGFEGPSGYSQRFGLYHVNFDDSSRPRTARKSAYFF
TSMIEKNGFLNKVVKRQSPPSIANVPRKIRAFSFPSEVPSKAKVVWEKFSNQPKFERDLF
YHGTFRDDFLWGVSSSAYQIEGAWDADGKGPSIWDNFTHTPGSNVKDNATGDVACDSYNH
LDADLNMLQALKVKAYRFSISWSRIFPTGRNTSVNAHGVDYYNKLINGLVENNISPMVTL
FHWDLPQALQDIGGWENPLLVDLFNSYADFCFQTFGDRVKFWMTFNEPTYQAWLGYGSGE
FPPNVNDSGSGPYRIGHAIIKAHARVYHTYDEKYRQEQKGVISLSLSSHWAEPQSLVPRD
VEAADRMLQFSLGWFAHPIFRNGDYPDAMKWKVGNRSELQHLATSRLPSFTEEEKQYIAA
TADVFCLNTYSSRIVQHTTPRLNPPSYTSDQELLEWEDTSWPATAMNRAAAWGMRRLLNW
IKEEYGDIPVYITENGVGLTDPKLEDTDRIFYHKTYINEALKAYRLDGVNLRGYAAWSLM
DNFEWLNGYTVKFGLYHVDFDDVNKSRTARASARYYTEVITNNGMPLSKEDEFLYGQFPK
DFIWSAATASYQIEGAWRADGKGLSIWDTFSHTPLKVENNDTGDVACDSYHKIAEDLAAL
QTLGVTHYRFSISWTRILPDGTNKYVNEAGLDYYLRLIDTLLAANIQPQVTIYHWDLPQA
LQDVGGWENETIVQRFKEYAEVLFQRLGDKVKFWITLNEPYVVAYQGYGYGTAAPGISFR
PGTAPYIVGHNLIKAHAEAWHLYNDVYRARQGGVISITISSDWAEPRDPSNQEDVEAAKR
YVQFMGGWFAHPIFKNGDYPEVMKTRIRDRSLAEGLNKSRLPEFTESEKRRINGTYDFFG
FNHYTTVLAYNLNYASWISSFDADRGVASITDRSWPDSGSFWLKMTPFGFRRILNWLKEE
YNNPPIYVTENGVSHRGEANLNDTARIYYLRSYINEALKAMQDKVDLRGYTVWTLMDNFE
WATGFSDKFGLHFVNYTDPALPRIPRESAKVYASIIRCSGFPDPAAGPHPCLQQEDAEPT
ASPVRQNIQFLGLRLSTTEAQTALNVLFAFMLLGVCCVALLSYKYFKRSKQKHTQPGEQE
LSHRSSF
NT seq 5784 nt NT seq  +upstreamnt  +downstreamnt
atggagctggcctggcatttagtccttactgttcttttaagtttttcttgctggggttta
gactgggactctgataaaaatttcatctcagctgctggtcctctaaccaacagcttgcta
cacgacctgagagatcccctgggaaaccaggcttctccatttgtagcagaagatgaagaa
atttacgtttgtcgccagccactgcctgcattcctgccagagtactttagaagtgtccgc
gccagtatgatcacccattacaaagtatttctgccatgggcacaacttctcccagaagga
atctcggagaacccagacaaggaaacagtgctgtgctataggcaactgcttgaagccctc
aagactgctcagcttcagcccttggtggttctacaccaccagaccctccctgccagcact
ctccagagaactgagacctttgccgatctctttgcggcctatgcctcctttgccttccac
tcctttggggacctagttgagatctggttcacttttagtgatttggagagagtgatcacg
aagcttccccaccaggaatcaagatcttcacgtctgcagatgctcactgatgcccacaga
aaagcctatgagatttaccatgaaaaatatgcttctcaaggtggaaaactctctgtggtc
ctgcgagctgagatgctctccaagctcctgctagaaccatctatgtctacacttgtcaag
gatgcagttgacttcatctctcttgatttatcttatgaatgccacagtgaggcagattta
ccacagacgttgagtgaactgcagaccactgaaccaaaagtgaaagttttcgtcttcagc
ctgaaactccagaactgcctctccaccaggaacaacgtagcccatctgctcttcagcctg
ctcaaagccataaatgaagaccaaatgctcgtcattgggtttgatattagtacattcctg
agctgttcatcgagttccaagaaaagctggtcttgttctctgagtgacagcctgaccctc
cagactgccccgcagctgggcccagacacagcagtatacgcctggtcgccccgctcagcc
tatcagagggtctgggaagcgtttgccaaccagtccaaggcagaacgggatgctttcctg
caggatgtttttcctgaaggcttcctctggggtgtctccacgggagcttttaacgtggaa
ggaggctgggccgaggatggaagagggccgagcatctgggacagagttgggcaccagaac
accaacaagggccaagcaacgccagaggtggccagcgacagttaccacaaggcagacact
gacgttgccctgctccgtggcctccaggcccaggtctacaagttctccatctcctggtcc
cgcatcttccccactgggcaggggcgtaaccccaacccccggggtgttgcctactacaac
aaactgattgacagcctgctggactcgcacatcgagcccatggccaccctgttccactgg
gacctgccccaggccctgcaggatcgcggtgggtggcagagtgaagatgtggtggacgcc
ttcctggactatgcagccttctgcttctccacgtttggggaccgtgtgaagctatgggtg
accttccacgagccgtgggtgatgagctacgcgggctacggcaccggccagcacgcaccg
ggcatctccgacccaggggtggcctcttttaaggtggcccacatggtcctcaaggcgcac
gccagggcttggcaccactacaacagccaccaccgcccacagcagcaggggcgtgtgggc
atcgtgctgaactcagactgggcagaacccctgtccccagagaggcctgaggacctgaga
gccgccgaacgcttcctgcacttcatgctgggctggtttgcacaccccatctttgtggat
ggggactacccggctgccctgagggcccagattcaacagatgaacaagcagtgccccagt
cctgtggcccagctccctgagttcaccgaggcagagaaacagctcttgaaaggctctgct
gattttctgggtctgtcccattacacttcccgcctcatcagcaaggcccgaggagatacc
tgcatccccagctatgataccatcggaggcttctcccagcatgtggaccccacatggccc
cagaccgcatccccttggattcgtgtggtgccctggggcataaggaggctgttgaacttt
gtatccttggaatacacaaaaggcaaagttccaatctacctagctgggaacggcatgccc
ataggggagagtgaagacctcatcgatgattccctgagagtcgactatttcaaccagtat
atcaatgaggtgctcaaggctatcaaagaagactcggtggttgttcagtcttacatcgct
cgctccttcattgatggctttgaaggcccttctgggtatagccagaggtttgggctgtac
catgtcaacttcgatgacagcagcaggccaaggactgccaggaaatctgcctattttttc
accagcatgatcgaaaaaaatggtttcctcaacaaggtagtaaaaagacagtcaccaccc
agcatagcaaacgtcccccggaaaatcagagccttctcttttccatccgaggtgccctcc
aaggcaaaagtggtctgggagaagttctccaaccaacccaagtttgagagagatctgttc
taccacggcacattccgcgatgactttctgtggggcgtgtcctcgtcagcctatcagatt
gaaggagcttgggacgctgacggcaaaggccccagcatctgggacaactttacccacaca
ccagggagcaacgtgaaagacaatgccactggagacgtggcctgtgacagctataaccac
ctggatgccgacctgaacatgctccaagcattgaaggtgaaggcttatcgcttctccatc
tcctggtctcggattttcccaactgggagaaacacttctgtcaacgcacatggtgtggat
tattacaacaagctgatcaatggcttggtggaaaacaacatctctcccatggtgaccctg
ttccactgggacctgccccaggccctgcaggacatcggaggctgggagaatcctttactg
gttgacttgttcaacagctatgcagacttctgcttccagacctttggtgacagagtcaag
ttctggatgacttttaatgagcccacgtaccaggcctggttgggatatggctcaggggaa
tttcccccaaatgtgaatgactcaggcagtggaccttaccggattggccatgcaatcatc
aaagctcatgccagagtctatcacacgtacgacgagaagtacaggcaagagcagaagggg
gtcatctccttgagcctcagttcccactgggcagagccccagtcgctggtccccagggac
gtggaggcagctgaccggatgctgcagttctccttgggttggtttgcccaccccatcttc
cgaaacggagactaccccgatgccatgaagtggaaggtggggaacaggagtgaactgcag
cacttggccacctcccgcctgcccagcttcacggaggaggagaagcagtacatcgcagct
accgccgacgtgttctgcctcaacacttactcctccaggattgtgcaacacacgacaccc
aggttaaacccaccctcctacacaagtgaccaggagctgctggagtgggaggacacttcc
tggcctgccacagccatgaacagggctgccgcctgggggatgcggagactgctcaactgg
atcaaggaagagtatggggacatccccgtttacatcactgagaacggagtggggctgaca
gaccccaaactggaagacaccgacaggatattttaccacaaaacctatatcaatgaagct
ttgaaagcctacagacttgatggtgtcaaccttcgaggatatgctgcctggtccctgatg
gacaactttgagtggctgaatggctacacggtcaagtttggactgtaccatgttgatttt
gatgacgtgaacaagtctcgcacagcaagagcctcagccaggtactacacagaggtcatc
accaacaatggcatgccgctgtccaaagaggatgagttcctatacggacagttccccaag
gacttcatctggagtgcagctaccgcctcatatcagatcgaaggtgcatggagagcagac
ggcaaaggactcagtatctgggacacgttttctcacacacccctgaaggttgagaacaat
gacacaggagacgtggcctgtgacagttaccacaagatcgccgaggacctggccgccctg
cagaccctgggcgtgacccactatcgcttttccatctcttggactcgcatcctccccgac
gggaccaacaagtacgtcaacgaggcgggcctggactactacctgcggctcatcgacacg
ctgctggccgccaacatccagccccaggtgactatttaccactgggacctgccccaggca
ctccaggatgttgggggctgggagaatgagacaattgtacagcggtttaaggagtatgca
gaggtgctgttccagaggctaggggacaaggtgaagttttggatcacactgaatgagccc
tacgtcgttgcttaccagggctacggctacgggacggcagctccagggatctcctttagg
cccggcactgccccctacattgttggccacaacctgataaaggctcacgctgaggcctgg
catctgtacaatgacgtgtaccgtgcccggcaaggtggcgtcatctccatcaccatcagc
agcgactgggctgagcccagagacccctccaaccaggaggatgtggaggcagccaagaga
tacgttcagttcatgggaggctggttcgcacatccgatattcaagaatggggattaccct
gaggtgatgaagacgcggatccgtgacaggagcttagcggaaggcctcaacaagtctcgg
ctccctgagttcacggagagtgagaagaggaggatcaacggcacctacgacttttttggg
ttcaatcactacaccactgtcctggcctacaatttaaactatgcctcttggatctcttcc
ttcgatgcagacaggggagtggcctccatcacagaccgctcctggccagactccggctcc
ttctggctgaagatgaccccttttggcttcaggaggatcctgaactggttgaaggaggaa
tacaacaaccccccgatctatgtcacagagaacggagtctcccatcggggagaagcaaac
ctcaatgacactgcaaggatctactacctccgcagctacatcaacgaggcgctcaaagct
atgcaggataaggtggaccttcgaggatacacggtttggactctgatggacaacttcgag
tgggccaccggcttctcagataagtttggtttgcattttgtgaactatactgaccctgct
ctgccaaggatccccagagagtcagccaaggtctacgcctccataatccggtgcagtggc
ttccccgaccctgctgcagggccacatccttgtcttcagcaagaagatgctgagcccacc
gccagccccgtgagacagaacattcagttcctgggcctcaggctgagtacgacggaagcc
cagacagcgcttaatgtgctctttgctttcatgcttcttggagtctgttgtgttgcactt
ctgtcctacaagtattttaagcgttccaagcaaaagcacacacaaccaggtgaacaggaa
ttgagccacaggtcttcattctga

DBGET integrated database retrieval system