KEGG   Bos taurus (cow): 516241Help
Entry
516241            CDS       T01008                                 

Gene name
CSAD
Definition
(RefSeq) cysteine sulfinic acid decarboxylase
  KO
K01594  sulfinoalanine decarboxylase [EC:4.1.1.29]
Organism
bta  Bos taurus (cow)
Pathway
bta00430  Taurine and hypotaurine metabolism
bta01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    516241 (CSAD)
Enzymes [BR:bta01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.29  sulfinoalanine decarboxylase
     516241 (CSAD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase DUF4910 SepSecS Aminotran_1_2 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-GeneID: 516241
NCBI-ProteinID: XP_005206297
Ensembl: ENSBTAG00000007829
VGNC: 27749
UniProt: E1BP41
LinkDB All DBs
Position
5
AA seq 493 aa AA seqDB search
MADSQPLLSLDGDPVAAEALLQDVFGIVVDEVIRKGTSASEKVCEWKEPEELKQLLDLEL
RHEGESQEQILEHCRAVIRYSVKTCHPRFFNQLFSGLDPHALAGRIVTESLNTSQYTYEI
APVFVLMEEEVLKKLRALVGWSSGDGVFCPGGSISNMYAVNLARYQRYPDCKQRGLRALP
PLALFTSKECHYSIKKGAAFLGLGTDSVRVVKADERGKMIPEDLERQISLAKAEGAVPFL
VSATSGTTVLGAFDPLEAIADVCQHHGLWLHVDAAWGGSVLLSQTHRHLLAGIQRADSVA
WNPHKLLSTGLQCSALLLRDTSNLLKRCHGSQASYLFQQDKFYDVALDTGDKVVQCGRRV
DCLKLWLMWKAQGEQGLQRRVDQAFALARYLVEELKKREGFELVMEPEFVNVCFWFVPPS
LRGKKGSPDYSERLSKVAPILKERMVRKGSMMIGYQPHGTRSNFFRMVVANPALTRADMD
FLLNELERLGQDL
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggctgactctcaacctctcctctcccttgatggggaccctgtggctgcagaagccttg
ctccaggacgtgtttgggattgtggtggatgaggtcattcgaaaagggaccagtgcctcc
gagaaggtctgtgagtggaaggagcccgaggagctgaagcaactgctggacttggagctg
cggcacgagggcgagtcacaggagcagatcctggagcactgccgggccgtgatccgctac
agcgtgaagacctgtcaccctcgtttcttcaaccagctcttctcagggttggatccccat
gccctggccgggcgcattgtcacagagagcctcaacaccagccagtacacgtacgaaatc
gcccctgtgtttgtcctcatggaggaggaggtgctgaagaaactccgggccctggtgggc
tggagctctggggatggggtcttctgccctggtggctccatctccaacatgtatgcagtg
aacctggcccgctatcagcgatacccagactgcaaacagaggggcctccgggcactgccg
cccctggccctcttcacatcgaaagagtgtcattactccatcaagaaaggagccgctttt
ctgggacttggcaccgacagtgtccgagtggtcaaggcagatgagagagggaaaatgatc
cctgaggatctggagaggcagatcagcttggctaaggccgagggtgccgtgccattcctg
gtcagtgccacctctggtactacagtgctgggggcctttgaccccctggaggcaatcgca
gatgtgtgccagcatcacgggctgtggctgcatgtggacgctgcctggggtggaagcgtc
ctgctgtcacagacacatagacatctcctggctgggatccagagggctgactccgtggcc
tggaatccccacaagctcctctccacaggcctgcagtgctcagctcttcttctccgggac
acctcgaacctgctcaagcgctgtcacgggtcccaggccagctacctcttccagcaagac
aagttctacgatgtggctctggacacaggagacaaggtggtgcagtgtggccggcgtgtg
gactgtctgaagctgtggctcatgtggaaggcacagggcgagcaggggctgcagcgccgt
gtggaccaggcctttgcccttgcccggtacctggtggaggagctgaagaagcgggaggga
tttgagttggtcatggagcctgaatttgtcaatgtgtgtttctggttcgtgccccccagt
ctgcgcgggaagaaggggagtccagattacagtgaaaggctgtctaaggtagccccaatc
ctcaaggagcgcatggtgaggaagggttccatgatgattggctaccagccccatggtacc
cggagcaacttctttcgcatggttgtggccaaccctgcactgacacgggctgatatggac
ttcctgctgaacgagctggaacggctgggccaggatctctga

DBGET integrated database retrieval system