KEGG   Bos taurus (cow): 517559Help
Entry
517559            CDS       T01008                                 

Gene name
HDAC4
Definition
(RefSeq) histone deacetylase 4 isoform X1
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
bta  Bos taurus (cow)
Pathway
bta04371  Apelin signaling pathway
bta05034  Alcoholism
bta05165  Human papillomavirus infection
bta05169  Epstein-Barr virus infection
bta05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    517559 (HDAC4)
 09160 Human Diseases
  09161 Cancers
   05203 Viral carcinogenesis
    517559 (HDAC4)
  09164 Substance dependence
   05034 Alcoholism
    517559 (HDAC4)
  09167 Infectious diseases
   05169 Epstein-Barr virus infection
    517559 (HDAC4)
   05165 Human papillomavirus infection
    517559 (HDAC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bta03036]
    517559 (HDAC4)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     517559 (HDAC4)
Chromosome and associated proteins [BR:bta03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     517559 (HDAC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln Oxidored_nitro
Motif
Other DBs
NCBI-GeneID: 517559
NCBI-ProteinID: XP_024846045
Ensembl: ENSBTAG00000017764
VGNC: 50611
LinkDB All DBs
Position
3
AA seq 1167 aa AA seqDB search
MDLKRNTVKISSLLGALDFVAETAEGSSDLRMEVLARSLPHRHSHRKQRTQWDGLSGRDQ
PVELLNPARVNHMPSTVDVASALPLPVAPPGVPMDLRLDHQFPLPVAEPGLREQQLQQEL
LALKQKQQLQRQILIAEFQRQHEQLSRQHEAQLHEHIKQQQELLAMKHQQELLEHQRKLE
RHRQEQELEKQHREQKLQQLKNKEKGKESAVASTEVKMKLQEFVLNKKKALAHRNLNHCM
SSDPRYWYGKTQHSSLDQSSPPQSGASASYNHPVLGMYDAKDDFPLRKTASEPNLKLRSR
LKQKVAERRSSPLLRRKDGPVVTALKKRPLDVTDSACSSAPGSAPSSPNNSSGNVSTENG
IAPAVPSIPAETSLAHRLVAREGSVGPLPLYTSPSLPNITLGLPATGPSTGAAGQQEAER
LALPALQQRISLFPGTHLAPYLGAAPLERDAGAAPGSLLQHVVLLEQPPTQTPLVTDRYL
AGLGALPLHAQPLVGAERVAPSVHKLRQHRPLGRTQSAPLPQSTQALQHLVIQQQHQQFL
EKHKQHFQQPQLHLNKQPRPKGSCPEVCVPQSNIWMITPDLLSAASGTKMIPKPSEPARQ
PESHPEETEEELREHQALLEEPFLDRLPGQKEAHTLAGVQVKQEPIESDDEETEPPREAE
PGQRPPTEQELLFRQQALLLEQQRIHQLRNYQASMEAAGIPVSFGGHRPLSRAQSSPASA
TFPMSVQEPPAKPRFTTGLVYDTLMLKHQCTCGNTNSHPEHAGRIQSIWSRLQETGLRGK
CECIRGRKATLEELQTVHSETHALLYGTNPLNRQKLDSKKLLGSLTSVFVRLPCGGVGVD
SDTIWNEVHSSGAARLAVGCVVELVFKVATGELKNGFAVVRPPGHHAEESTPMGFCYFNS
VAIAAKLLQQRLSVSKTLVVDWDVHHGNGTQQAFYSDPRVLYISLHRYDDGNFFPGSGAP
DEVGTGAGVGFNVNMAFTGGLDPPMGDAEYLAAFRTVVMPIASEFAPDVVLVSSGFDAVE
GHPTPLGGYNLSAKCFGYLTKQLMGLAGGRVVLALEGGHDLTAICDASEACVSALLGNEL
DPLPEKVLQQRPNANAVRSMEKVIEIHSQYWRSLQRLASTAGYSLVEAQKCENEEAETVT
AMASLSVAVKAPEKRPDEEPMEEEPPL
NT seq 3504 nt NT seq  +upstreamnt  +downstreamnt
atggatttaaaaagaaacaccgtcaagatttcgtccctgttaggagctctcgattttgtg
gcagagacagcagagggatccagtgatcttaggatggaggtgttggcaaggagcctccca
catcggcactctcatcgcaagcagaggacacagtgggatggactttctggccgagaccag
ccggtggagctgctcaaccctgcccgcgtgaaccacatgcccagcaccgtggacgtggcc
tcggccctgcctctgccagtggcccccccgggggtgcccatggacctgcgcctggatcac
cagtttccgctgcccgtggcggagccgggtctccgcgagcagcagctgcagcaggagctc
ctggcgctcaagcagaagcagcagctgcagagacagatcctcatcgctgagttccagagg
cagcacgagcagctgtcgcggcagcacgaggcccagctgcacgagcacatcaagcaacag
caggagctgctggccatgaaacaccagcaggagctgctcgagcaccagcggaagctggag
cggcaccggcaggagcaggagctggagaagcagcaccgggagcagaagctgcagcagctg
aagaacaaggagaagggcaaagagagcgccgtggccagcacggaagtgaagatgaagctg
caggagtttgtcctcaataaaaagaaggccctggctcaccggaacctgaaccactgcatg
tccagcgaccctcgctactggtacgggaagacgcagcacagctcgctggaccagagctcc
ccgccccagagcggggcgtcagcctcctacaaccacccagtcctgggcatgtatgacgcc
aaagacgacttccccctcagaaagacagcttctgaacccaacctgaaattacgctccagg
ctaaagcagaaagtggctgagagacggagcagccccctgctacgcaggaaagatgggcca
gtggtcacggctctgaaaaagcgtcccttggatgtcacagactcggcgtgcagcagtgcc
ccaggctccgcgcccagctcgcccaacaacagctccgggaacgtgagcacggagaacggg
atcgcgcccgccgtccccagcatcccagccgagaccagcctggcacacagactcgtggca
cgagagggctcggtgggtccgctgcccctctacacgtcaccatccctgcccaacatcaca
ctggggctgcccgccaccggcccctccacgggggcggccggccagcaggaggccgagaga
ctggccctccccgccctgcagcagcgcatctccctcttccctggtacccacctcgccccc
tacctgggcgcagcgcctctggagcgggacgcgggggcagccccgggctccctcttgcag
catgtggtcctcctggagcagccgcccacgcagacgcccctcgtcacagaccgctacctt
gcaggcctgggcgcgctgcccctgcacgcgcagcccctggtaggggcggagcgagtggcc
ccctcggtgcacaagctgcggcagcaccgcccgctgggccgcacgcagtcggcgccgctg
ccccagagcacgcaggcgctgcagcacctggtcatccagcagcagcaccagcagttcctg
gagaagcacaagcagcacttccagcagccgcagctgcacctcaacaagcaacctcggcca
aagggctcctgcccagaggtctgcgtccctcaatccaacatctggatgatcactcccgac
ctgctttcagcagcaagcggcaccaagatgatccccaaacccagcgagccggcccggcag
cccgagagccaccccgaggagacagaggaggagctgcgggagcaccaggcgctcctggag
gagcccttcctggaccggctcccagggcagaaggaggcccacacactggccggggtgcag
gtgaagcaggagcccatcgagagtgatgacgaggagacggagcccccgcgggaggcggag
cccggccagcggccgcccacagagcaggagctgctcttcagacagcaagccctcctcctg
gagcagcagcggatccaccagctgaggaactaccaggcgtccatggaggctgctggcatc
cccgtgtcctttggcgggcaccggcccctgtcccgggcacagtcctcccccgcatccgcc
accttccccatgtccgtgcaggagcccccagccaagccaaggttcaccacaggcctcgtg
tacgacactctgatgctgaaacaccagtgcacctgcgggaacaccaacagccacccagag
cacgccgggcgcatccagagcatctggtcgcggctgcaggagaccggcctgcgaggcaaa
tgtgagtgcatccgcggacgtaaggccacgctggaggagctgcagacagtgcactcggag
acacacgccctgctgtacggcacgaaccccctcaacaggcagaaactggacagtaagaaa
cttctaggctcactaacgtccgtgttcgtcaggctgccctgcggtggtgtcggggtggac
agtgacaccatatggaacgaggtgcactcgtcgggggccgcccgcctggccgtgggctgt
gtggtagagctggtcttcaaggtggccacgggggagctgaagaatggctttgctgtggtc
cgccctccaggacaccacgcagaggagagcacgcccatggggttctgctacttcaactcc
gtagccatcgctgccaagcttctccagcaaaggctgagcgtgagcaagaccctcgtggtg
gactgggatgtgcaccatgggaacgggacccagcaggccttctatagcgacccccgcgtg
ctctacatctccctgcaccgctacgacgacggcaacttcttcccgggcagcggcgcgcct
gacgaggtgggcacgggcgccggcgtgggctttaacgtcaacatggctttcaccggcggc
ctggacccccccatgggagacgcagagtacctcgcagccttcaggaccgtggtcatgccg
atcgccagcgagttcgccccggacgtggtgctggtgtcctcgggcttcgatgccgtggag
ggccaccccacgcccctcggaggctacaacctctccgccaagtgtttcgggtacctgaca
aagcagctgatgggcctggccggcggccgggttgtcctggcgctggaggggggccacgat
ctcacagccatctgcgacgcctcggaagcctgcgtctctgccctgctggggaatgagctc
gatcctctcccagaaaaggtcttacagcagagacccaatgccaacgctgtgcggtcgatg
gagaaggtcattgaaatccacagccagtactggcgctccctgcagaggcttgcctccacc
gctggctactccctagtcgaggcccagaagtgtgagaacgaggaagccgagactgttact
gccatggcctcgctgtctgtggcggtgaaggcccctgagaagagacccgacgaggagccc
atggaagaggagccgcctctgtag

DBGET integrated database retrieval system