KEGG   Bos taurus (cow): 518647Help
Entry
518647            CDS       T01008                                 

Gene name
TMPRSS9
Definition
(RefSeq) transmembrane protease serine 9 isoform X1
  KO
K09640  transmembrane protease serine 9 [EC:3.4.21.-]
Organism
bta  Bos taurus (cow)
Brite
KEGG Orthology (KO) [BR:bta00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bta01002]
    518647 (TMPRSS9)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     518647 (TMPRSS9)
Peptidases [BR:bta01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   518647 (TMPRSS9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Trypsin_2 Ldl_recept_a SEA
Motif
Other DBs
NCBI-GeneID: 518647
NCBI-ProteinID: XP_010805365
Ensembl: ENSBTAG00000000718
VGNC: 36145
UniProt: E1B9Z9
LinkDB All DBs
Position
7
AA seq 1095 aa AA seqDB search
MEPTASDLQLVPGATKDVLAADAMCCRAALSTVVATSIVLVILGVLVASLSTQGVDVEHM
AELRGIRFAPSLQQETSEYYRTLTPALEMLFVSSFQETELESSCLGCTVLSYWEGNASVL
VRFRLHFLLLALWTPSPGLEEQLLQRGLHARLQGLGIPLAPYGTIVSAQLTGSQKGPLTE
RDLKSGHCPGNVFSCGNSQCVTKVNPECDDTADCSDGSDEAHCDCGLQPGWKTAGRIVGG
VEASPGEFPWQVSLRENNEHFCGAAIISARWLVSAAHCFNEFQDSPEWVAYVGTTYLSGS
EASMVRARVARIITHPSYNSDTADFDVAVLELGRPLPFSRHVQPVCLPAASHIFPPRKKC
LISGWGYLKENFLVKPEMLQKATVELLDQALCTSLYGHSLTDRMVCAGYLDGKVDSCQGD
SGGPLVCEESSGRFFLAGIVSWGIGCAEAQHPGVYARVTSLRDWILETIASASKPPAPTV
ALASTTLSTAWPTSPKSLVTDTLTKPTLAPSTMPLDLATASKPQECGARPALEKPTRIVG
GLGASLGEVPWQVSLKEGSRHFCGATVVGDRWLLSAAHCFNHTKVELVRAQLGTASLSGV
GGSPVKVGLRRVVLHPQYNPSILDFDVAVLELARPLVFNKYVQPVCLPLAIQKFPVGRKC
VISGWGNTQEGNATKPDLLQQASVGIIDHKACSALYNFSLTDRMICAGFLEGKVDSCQGD
SGGPLACEETPGVFYLAGIVSWGIGCAQVKKPGVYTRITRLKGWILATMSSHLLPTAPLP
TTRMPTSSHATRTTAGLTVPEVMASTPTPWATSRVTSQPADRTTTTVTSTPRGQTPLPPA
PKTTVGAQLPDCGLAPAAALTRIVGGSAAGRGEWPWQVSLWLRRREHRCGAVLVAERWLL
SAAHCFDVYGDPKQWAAFLGTPFLSGADGQLERVARIHKHPFYNLYTLDYDVALLELVGP
VRRSRLVRPICLPEPAPRPPDGARCVITGWGSVREGGSMARQLQKAAVRLLSEQTCRRFY
PVQISSRMLCAGFPQGGVDSCSGDAGGPLACREPSGRWVLTGVTSWGYGCGRPQFPGVYT
RVAAVRGWIGQNIQE
NT seq 3288 nt NT seq  +upstreamnt  +downstreamnt
atggagcccactgccagtgacttacagctggtgcctggagccaccaaggacgtcctggct
gcagatgccatgtgctgccgggcggccctgtccactgttgtggccaccagcatcgtcctc
gtcatcctgggagtccttgtggcctccctctctacacagggcgtcgacgtagagcacatg
gctgagctgcgtgggatccggtttgcccccagcttgcagcaggagacctcagagtactac
cgcacgctgacgcccgctctggaaatgctgtttgtcagcagctttcaagagacagagttg
gagtccagctgcctgggctgcacggtgctgagttactgggagggcaacgccagcgtcctg
gtgcgtttccggctgcactttctgctgctggccctgtggacgccaagcccaggcctggag
gagcagctattgcagcggggacttcatgcgaggctgcagggcctcggcatccccctagcc
ccctatggcaccattgtgtctgcccagctcacaggaagccagaaggggccgctgacagaa
agagacttaaaatcaggccactgtccagggaatgtcttttcctgcgggaacagccagtgt
gtgaccaaggtgaacccagagtgtgatgacaccgcggactgctccgacggctccgacgag
gcccactgcgactgtggcttgcagcctggctggaagacagctggcaggattgtgggtggt
gtggaagcgtccccaggggagttcccttggcaagtcagcctccgtgaaaacaacgagcac
ttctgtggggccgccatcatcagcgccaggtggctggtgtccgctgcccactgcttcaac
gaattccaggactccccggagtgggtggcttacgtgggcaccacctacctcagcggctca
gaggccagcatggtgcgggcccgcgtggcccggatcatcacacacccatcctacaactcg
gacacagctgacttcgacgtggcggtgctggagctgggcagacccctgcccttcagccgg
cacgtgcagcccgtgtgcctgccggctgcctcacacatcttcccaccaaggaagaagtgc
ctcatctcaggctggggctacctcaaggagaacttcctggtcaagccggaaatgctgcag
aaggccactgtggagctgctggaccaggccctgtgcaccagcctatacggccactcactc
accgacaggatggtgtgtgctggctacctggacgggaaggtggattcctgccagggtgac
tcggggggccccctggtctgcgaggagtcctccggcaggttcttcctggctggcatcgtg
agctggggaatcggctgtgcggaagcccagcatccaggggtctacgcccgagtgaccagt
ctgcgggactggatcctggagaccatcgcttctgcaagcaagcctccagcccccacagtg
gctctcgcctccaccactctcagcactgcctggcccaccagccccaagagcctggtgact
gacaccctcaccaaacccacactggcccctagcactatgcctctagacttggccactgct
tctaagccacaagagtgtggggccaggccagcgctggagaagcccactcggatcgtgggg
gggcttggggcctccttgggggaggtgccttggcaggtcagcctgaaggagggctcgcgg
cacttctgcggagccaccgtggtgggggaccgctggctgctgtctgccgcccactgcttc
aaccacacgaaggtggagctggtgcgggctcagctgggcactgcgtccctgtcgggcgtt
ggcgggagccccgtgaaggtggggctcaggcgggtggtgctgcacccccagtacaacccc
agcatcctggacttcgacgtggccgtgctggagctggccaggcctttggtcttcaacaag
tatgtgcagcccgtctgcctgccactggccatccagaagttccctgtgggccgcaagtgt
gtgatctccgggtggggcaacacgcaggagggcaacgccaccaagcctgacctcctgcag
caggcgtctgtgggcatcatagaccacaaggcatgtagcgccctctacaacttctcgctc
acggacaggatgatctgcgccggcttcctggagggcaaggtggattcctgccagggtgac
tctgggggacccctggcctgtgaggagacacccggtgtgttttatctggctgggatcgtg
agctggggcatcggctgtgcgcaggtcaagaagccgggtgtgtacacccgcatcacccgg
ctcaagggctggatcctggccaccatgtcctcccacttgctccccacggccccgctgccc
accacgaggatgcccaccagcagtcatgccaccaggacgacagcaggcctcacagtcccg
gaagtcatggccagcacacccactccctgggccaccagcagggtgaccagtcaacctgcc
gacaggaccaccacaactgtgacctccacccctaggggccagacaccactgcccccagct
ccgaagaccacggtgggcgcccagctaccagactgcggcctggcgccggctgcggcgctg
acccggatcgtgggcggcagcgctgcgggccgcggggagtggccgtggcaggtgagcctg
tggctgcggcggcgggagcaccgctgcggggctgtgctggtggcggagaggtggctgcta
tcggcggcacactgcttcgacgtctacggggaccccaagcagtgggcagccttcctgggc
acgccgttcctgagtggcgctgatgggcagctggagcgtgtggcgcgcatccacaagcac
cccttctacaacctctacacgctcgactacgacgtggcactgctcgagctggtggggcca
gtacgccgcagccgcctggtgcggcccatctgcttgcctgagcccgccccacggcccccc
gacggcgcgcgctgcgtcatcacaggctggggctctgtgcgcgagggaggctccatggcc
aggcagctgcagaaggcggccgtgcgcctcctcagcgagcagacctgccgccgcttctac
ccggtacagatcagcagccgcatgctgtgtgccggcttcccgcagggaggcgtggacagc
tgctcgggtgacgctgggggacccctggcctgcagggagccctccggccgctgggtgctc
actggggtcaccagctggggttatggctgtgggcggccccagttcccgggcgtgtacacc
cgggtggctgctgtcagaggctggatcgggcagaacatccaggagtga

DBGET integrated database retrieval system