KEGG   Bos taurus (cow): 519331
Entry
519331            CDS       T01008                                 

Gene name
CACNG4
Definition
(RefSeq) voltage-dependent calcium channel gamma-4 subunit
  KO
K04869  voltage-dependent calcium channel gamma-4
Organism
bta  Bos taurus (cow)
Pathway
bta04010  MAPK signaling pathway
bta04260  Cardiac muscle contraction
bta04261  Adrenergic signaling in cardiomyocytes
bta04921  Oxytocin signaling pathway
bta05410  Hypertrophic cardiomyopathy
bta05412  Arrhythmogenic right ventricular cardiomyopathy
bta05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    519331 (CACNG4)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    519331 (CACNG4)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    519331 (CACNG4)
   04261 Adrenergic signaling in cardiomyocytes
    519331 (CACNG4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    519331 (CACNG4)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    519331 (CACNG4)
   05414 Dilated cardiomyopathy
    519331 (CACNG4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:bta04040]
    519331 (CACNG4)
Ion channels [BR:bta04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   519331 (CACNG4)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 AA_permease_2 DUF2269
Other DBs
NCBI-GeneID: 519331
NCBI-ProteinID: XP_002696273
BGD-bta: BT16242
Ensembl: ENSBTAG00000000589
VGNC: 26689
UniProt: A0A3Q1LKG2
LinkDB
Position
19
AA seq 321 aa
MVRCDRGLQTLLTTAGAFAAFSLMAIAIGTDYWLYSSAHICNGTNLTMDDGPPPRRTRGD
LTHSGLWRVCCIEGIYKGHCFRINHFPEDNDYDHDSSEYLLRIVRASSVFPILSTILLLL
GGLCIGAGRFYSRKNNIVLSAGILFVAAGLSNIIGIIVYISSNTGDPSDKRDEDKKNHYN
YGWSFYFGALSFIVAETVGVLAVNIYIEKNKELRFKTRREFLKAPSSSPYARMPSYRYRR
RRSRSSSRSTEASPSRDASPVGLKITGAIPMGELSMYTLSREPLKVTTAASYSPDQDAGF
LQVHGFFQQDLSMLSRRTTPV
NT seq 966 nt   +upstreamnt  +downstreamnt
atggtgcgatgcgaccgcgggctgcagacgctgctgaccacggccggagccttcgccgcc
ttctcgctcatggccatcgccatcggcacggactactggctctactccagcgcgcacatc
tgcaacggcaccaacctgaccatggacgacgggcccccgccccgccgcacccgcggcgac
ctcacccactcggggctgtggcgcgtgtgctgcatcgaagggatctataaaggacactgc
tttcggatcaaccacttcccagaggacaacgattacgaccatgacagctcggagtacctc
ctccgcatcgtgcgcgcctccagcgtcttccccatcctgagcaccatcctgctcctactc
ggcgggctctgcatcggcgcgggcaggttctacagccgcaagaacaacatcgtgctcagc
gccggcatcctcttcgtggccgcgggcctcagtaatatcatcggcatcatcgtctacatt
tccagcaacacgggcgaccccagtgacaagcgcgacgaagacaagaaaaaccattacaac
tatggctggtctttttacttcggagccctgtcgttcattgtggccgagaccgtgggcgtc
ctggcggtaaacatttacattgagaagaacaaggagctgcggtttaagaccagacgtgag
ttcctcaaggccccctcctcgtcgccctatgccaggatgccgagctaccggtaccggcgc
cggcgctcgcggtccagctctaggtccaccgaggcctcgccttccagggacgcgtcgccg
gtggggctgaagatcaccggggccatccccatgggcgagctgtccatgtacacgctgtcc
agggagcccctcaaggtgaccacggccgccagctacagcccggaccaggacgctggcttc
ctgcaggtgcacggcttcttccagcaggacctcagcatgctgagccggaggaccacgccc
gtgtga

DBGET integrated database retrieval system