KEGG   Bos taurus (cow): 521616
Entry
521616            CDS       T01008                                 

Gene name
CACNG6
Definition
(RefSeq) voltage-dependent calcium channel gamma-6 subunit
  KO
K04871  voltage-dependent calcium channel gamma-6
Organism
bta  Bos taurus (cow)
Pathway
bta04010  MAPK signaling pathway
bta04260  Cardiac muscle contraction
bta04261  Adrenergic signaling in cardiomyocytes
bta04921  Oxytocin signaling pathway
bta05410  Hypertrophic cardiomyopathy
bta05412  Arrhythmogenic right ventricular cardiomyopathy
bta05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    521616 (CACNG6)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    521616 (CACNG6)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    521616 (CACNG6)
   04261 Adrenergic signaling in cardiomyocytes
    521616 (CACNG6)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    521616 (CACNG6)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    521616 (CACNG6)
   05414 Dilated cardiomyopathy
    521616 (CACNG6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:bta04040]
    521616 (CACNG6)
Ion channels [BR:bta04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   521616 (CACNG6)
SSDB
Motif
Pfam: Claudin_2 PMP22_Claudin Phage_holin_3_6 DUF1686 DUF1700
Other DBs
NCBI-GeneID: 521616
NCBI-ProteinID: NP_001192817
BGD-bta: BT25134
Ensembl: ENSBTAG00000021657
VGNC: 26691
LinkDB
Position
18
AA seq 260 aa
MMWSNFFLQEENRRRGAAARRRARGQPKAQMTPEREGKIKLALLLTSVGATLAVLAVGTE
FWVELNTYRDNGSAVCDAAHLGLWKMCTKRLWQADVPAGRDTCGPAELPGEANCTYFKFF
TTGENAHIFQRTTKKEVNQAAAVIAVLGLAVMALGCLCIIMVLSKGAEFLLRVGAVCFGL
SGLLVLVSLEVFRHSVRALMQRVSPEPPVAPALTYEYSWSLGCGVGAGLILMLGGGCFLL
LALPPGPWSPLCPKWGQRAP
NT seq 783 nt   +upstreamnt  +downstreamnt
atgatgtggtccaacttcttcctgcaagaggagaaccgccggcggggggccgcggcccgg
cggcgggctcgtgggcagcccaaggcccagatgaccccggagcgcgagggcaagatcaag
ctggcgctgctgctgacctccgtgggcgccacgctggccgtgctggccgtcggcaccgag
ttctgggtggagctcaacacctaccgggacaacggcagcgccgtctgcgacgcggcgcac
ctgggcctctggaagatgtgcaccaaacgactgtggcaggcggacgtgcccgcgggcaga
gacacctgcgggcccgccgagctgcccggagaagcaaattgcacttattttaaattcttc
accacgggagagaatgcacacatcttccagagaaccacgaagaaagaggtgaatcaggca
gctgcagtgatagcagtgctaggcttggcagttatggccctggggtgcctctgtatcatc
atggtgctcagcaaaggtgcagagttcctgctccgggttggagccgtctgctttggcctc
tcaggcctgctggtcctcgtcagcctagaggtcttccggcattccgtgagagccttgatg
cagagggtcagccccgagccccccgtggccccggccctgacctacgagtactcctggtcc
ctgggctgtggcgtgggggccggcctgatcctgatgctgggaggtggctgctttctgctg
ctcgccctgcctcctggaccctggagtcccctctgtcccaagtggggccagagggccccc
tag

DBGET integrated database retrieval system