KEGG   Bos taurus (cow): 523047Help
Entry
523047            CDS       T01008                                 

Gene name
SUV39H1
Definition
(RefSeq) histone-lysine N-methyltransferase SUV39H1
  KO
K11419  histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
bta  Bos taurus (cow)
Pathway
bta00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    523047 (SUV39H1)
Enzymes [BR:bta01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     523047 (SUV39H1)
Chromosome and associated proteins [BR:bta03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     523047 (SUV39H1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    523047 (SUV39H1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET Chromo
Motif
Other DBs
NCBI-GeneID: 523047
NCBI-ProteinID: NP_001039729
BGD-bta: BT19036
Ensembl: ENSBTAG00000004706
VGNC: 35491
UniProt: Q2NL30
LinkDB All DBs
Position
X
AA seq 412 aa AA seqDB search
MAESLKGCSVCCKSSWNQLQDLCRLAKLSCPALGISKRNLYDFEVEYLCDYKKIREQEYY
LVKWRGYPDSESTWEPRQNLKCVRILKQFHKDLERELLRRHHRSKPPRHLDPSLANYLVQ
KAKQRRALRRWEQELNAKRSHLGRITVENEVDLDGPPRAFVYINEYRVGEGITLNQVAVG
CECQDCLWAPAGGCCPGASLHKFAYNDQGQVRLRAGLPIYECNSRCRCGYDCPNRVVQKG
IRYDLCIFRTDDGRGWGVRTLEKIRKNSFVMEYVGEIITSEEAERRGQIYDRQGATYLFD
LDYVEDVYTVDAAYYGNISHFVNHSCDPNLQVYNVFIDNLDERLPRIAFFATRTIRAGEE
LTFDYNMQVDPVDMESTRMDSNFGLAGLPGSPKKRVRIECKCGTESCRKYLF
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaagtttaaaaggctgcagtgtgtgttgcaaatcttcttggaatcagctacag
gacctgtgccgcctggccaagctctcctgccctgcccttggcatctccaagaggaacctc
tatgactttgaagtcgagtacctgtgcgattacaaaaagatccgcgaacaggagtattac
ctggtaaaatggcgtgggtacccagactccgagagcacttgggaaccacggcagaatctc
aagtgtgtgcgcattctcaagcagttccacaaggacttggaaagggagctgctccggcgg
caccaccggtcaaagccaccccggcacctggacccaagcctggccaactacctggtgcag
aaggccaagcagaggcgggcactccggcgctgggagcaggagctcaatgccaagcgcagc
cacctgggacgcatcaccgtggagaacgaagtggacctggatggccccccacgggccttc
gtgtacatcaacgagtaccgtgttggtgagggcatcaccctcaaccaggtggctgtgggc
tgcgagtgccaggactgtctgtgggcaccggccggaggctgctgccctggggcgtcactg
cacaagtttgcctacaatgaccagggccaggtgcgcctgcgagccgggctgcccatctat
gagtgcaactcccgctgccgctgtggctatgactgccccaaccgcgtggtacagaagggc
atccgctacgacctctgcatcttccgcacggatgatggacgcggctggggtgtccgcacg
ctggagaagatccgcaagaacagtttcgtcatggagtacgtgggcgagatcattacctca
gaggaggcagagcggcggggccagatctatgaccgccagggtgccacctacctcttcgac
ctggactacgtggaggatgtgtacactgtggacgccgcctattacggcaacatctctcac
tttgtcaaccacagttgtgaccccaacctccaggtgtacaacgtcttcatagacaacctt
gatgagcggctgccccgcattgctttctttgccaccagaaccatccgggcaggcgaggag
ctcacctttgattacaacatgcaagtggacccggtggacatggagagcacacgcatggac
tccaactttggcctggctgggctccccggctctcccaagaagcgggtccgcattgaatgc
aagtgtgggactgaatcctgccgcaaatacctcttctag

DBGET integrated database retrieval system