KEGG   Bos taurus (cow): 524530
Entry
524530            CDS       T01008                                 

Gene name
CCND1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
bta  Bos taurus (cow)
Pathway
bta01522  Endocrine resistance
bta04068  FoxO signaling pathway
bta04110  Cell cycle
bta04115  p53 signaling pathway
bta04151  PI3K-Akt signaling pathway
bta04152  AMPK signaling pathway
bta04218  Cellular senescence
bta04310  Wnt signaling pathway
bta04340  Hedgehog signaling pathway
bta04371  Apelin signaling pathway
bta04390  Hippo signaling pathway
bta04510  Focal adhesion
bta04530  Tight junction
bta04630  JAK-STAT signaling pathway
bta04917  Prolactin signaling pathway
bta04919  Thyroid hormone signaling pathway
bta04921  Oxytocin signaling pathway
bta04933  AGE-RAGE signaling pathway in diabetic complications
bta04934  Cushing syndrome
bta05160  Hepatitis C
bta05162  Measles
bta05163  Human cytomegalovirus infection
bta05165  Human papillomavirus infection
bta05166  Human T-cell leukemia virus 1 infection
bta05167  Kaposi sarcoma-associated herpesvirus infection
bta05169  Epstein-Barr virus infection
bta05200  Pathways in cancer
bta05203  Viral carcinogenesis
bta05205  Proteoglycans in cancer
bta05206  MicroRNAs in cancer
bta05210  Colorectal cancer
bta05212  Pancreatic cancer
bta05213  Endometrial cancer
bta05214  Glioma
bta05215  Prostate cancer
bta05216  Thyroid cancer
bta05218  Melanoma
bta05219  Bladder cancer
bta05220  Chronic myeloid leukemia
bta05221  Acute myeloid leukemia
bta05222  Small cell lung cancer
bta05223  Non-small cell lung cancer
bta05224  Breast cancer
bta05225  Hepatocellular carcinoma
bta05226  Gastric cancer
bta05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    524530 (CCND1)
   04340 Hedgehog signaling pathway
    524530 (CCND1)
   04390 Hippo signaling pathway
    524530 (CCND1)
   04371 Apelin signaling pathway
    524530 (CCND1)
   04630 JAK-STAT signaling pathway
    524530 (CCND1)
   04068 FoxO signaling pathway
    524530 (CCND1)
   04151 PI3K-Akt signaling pathway
    524530 (CCND1)
   04152 AMPK signaling pathway
    524530 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    524530 (CCND1)
   04115 p53 signaling pathway
    524530 (CCND1)
   04218 Cellular senescence
    524530 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    524530 (CCND1)
   04530 Tight junction
    524530 (CCND1)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    524530 (CCND1)
   04921 Oxytocin signaling pathway
    524530 (CCND1)
   04919 Thyroid hormone signaling pathway
    524530 (CCND1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    524530 (CCND1)
   05206 MicroRNAs in cancer
    524530 (CCND1)
   05205 Proteoglycans in cancer
    524530 (CCND1)
   05203 Viral carcinogenesis
    524530 (CCND1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    524530 (CCND1)
   05212 Pancreatic cancer
    524530 (CCND1)
   05225 Hepatocellular carcinoma
    524530 (CCND1)
   05226 Gastric cancer
    524530 (CCND1)
   05214 Glioma
    524530 (CCND1)
   05216 Thyroid cancer
    524530 (CCND1)
   05221 Acute myeloid leukemia
    524530 (CCND1)
   05220 Chronic myeloid leukemia
    524530 (CCND1)
   05218 Melanoma
    524530 (CCND1)
   05219 Bladder cancer
    524530 (CCND1)
   05215 Prostate cancer
    524530 (CCND1)
   05213 Endometrial cancer
    524530 (CCND1)
   05224 Breast cancer
    524530 (CCND1)
   05222 Small cell lung cancer
    524530 (CCND1)
   05223 Non-small cell lung cancer
    524530 (CCND1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    524530 (CCND1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    524530 (CCND1)
   04934 Cushing syndrome
    524530 (CCND1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    524530 (CCND1)
   05162 Measles
    524530 (CCND1)
   05160 Hepatitis C
    524530 (CCND1)
   05163 Human cytomegalovirus infection
    524530 (CCND1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    524530 (CCND1)
   05169 Epstein-Barr virus infection
    524530 (CCND1)
   05165 Human papillomavirus infection
    524530 (CCND1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    524530 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 524530
NCBI-ProteinID: NP_001039738
BGD-bta: BT11496
Ensembl: ENSBTAG00000017514
VGNC: 26962
UniProt: Q2KI22
LinkDB
Position
29
AA seq 295 aa
MAHQLLCCEMETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEILPSMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPDELLHMELVLVNKLKWNLAAMTPHDFIEHFLSKMPVAEENKQIIRK
HAQTFVALCATDVKFISNPPSMVAAGSVAAAAQGLHLGSANGFLSYHRLTRFLSKVIRCD
PDCLRACQEQIEALLESSLRQAQQQNLDPKAAEEEEEEEEVDLACTPTDVRDVNI
NT seq 888 nt   +upstreamnt  +downstreamnt
atggcacaccagctcctgtgctgcgagatggagaccatccgccgggcgtaccccgatgcc
aacctcctcaacgaccgagtgctgcgggccatgctcaaggcggaggagacctgcgcgccc
tcggtgtcctacttcaagtgtgtgcagaaggagatcctgccgtccatgcggaagatcgtg
gccacctggatgctggaggtctgcgaggagcagaagtgcgaggaagaggtcttcccgctg
gccatgaactacctggaccgcttcctgtcgctggagcccgtgaaaaagagccgcctgcag
ctgctgggggccacctgcatgttcgtggcctcgaagatgaaggagaccatccccctgacg
gccgagaagctgtgcatttacactgacaactccatccggcccgacgagctgctgcacatg
gagctggtcctggtgaacaaactcaagtggaacctggcggccatgaccccgcacgacttc
atcgagcacttcctctccaagatgccggtggccgaggagaacaagcagatcatccgcaaa
cacgcgcagaccttcgttgccctctgtgccacagacgtgaagttcatttccaacccgccc
tccatggtggccgccgggagcgtggcggccgcggctcaaggcctgcatctgggaagcgcc
aacggcttcctctcctatcaccgcctgacgcggttcctctccaaggtgatcagatgtgac
ccggactgcctccgcgcctgccaggagcagatcgaagccctcctggagtccagcctgcgc
caggcccagcagcagaacttggaccccaaagccgcggaggaggaagaggaggaggaggag
gtggacctggcctgcacgcccaccgacgtgcgtgacgtgaacatctga

DBGET integrated database retrieval system