KEGG   Bos taurus (cow): 529382
Entry
529382            CDS       T01008                                 

Gene name
CACNG5
Definition
(RefSeq) voltage-dependent calcium channel gamma-5 subunit
  KO
K04870  voltage-dependent calcium channel gamma-5
Organism
bta  Bos taurus (cow)
Pathway
bta04010  MAPK signaling pathway
bta04260  Cardiac muscle contraction
bta04261  Adrenergic signaling in cardiomyocytes
bta04921  Oxytocin signaling pathway
bta05410  Hypertrophic cardiomyopathy
bta05412  Arrhythmogenic right ventricular cardiomyopathy
bta05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    529382 (CACNG5)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    529382 (CACNG5)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    529382 (CACNG5)
   04261 Adrenergic signaling in cardiomyocytes
    529382 (CACNG5)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    529382 (CACNG5)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    529382 (CACNG5)
   05414 Dilated cardiomyopathy
    529382 (CACNG5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:bta04040]
    529382 (CACNG5)
Ion channels [BR:bta04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   529382 (CACNG5)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 DUF716 Serinc DUF373
Other DBs
NCBI-GeneID: 529382
NCBI-ProteinID: NP_001192891
Ensembl: ENSBTAG00000012311
VGNC: 26690
LinkDB
Position
19
AA seq 275 aa
MGACGRKALTLLSSVFAVCSLGLLGIAVSTDYWLYLEEGVVLAQNQSTETRMSLHSGLWR
VCFLAGEEQGRCFTIEYVMPASAQLTSESTVSVLKMIRSATPFPLVSLFFMFIGFILSNI
GHVRPHRTILAFVSGIFFILSGLSLVVGLVLYISSINDEMLNRTRDTETYFSYKYGWSFA
FAAISFLLTESAGVMSVYLFMKRYTAEDLYRPHPGFYRPRLSNCSDYSGQFLHPDAWARG
RSPSDLSSDASLQMNSSYPALLKCPDYDQMSTSPC
NT seq 828 nt   +upstreamnt  +downstreamnt
atgggcgcctgtgggaggaaggccctgaccctgctgagcagcgtcttcgccgtgtgcagc
ctgggcctgctgggcatcgccgtcagcacggactactggctgtacctggaggagggcgtg
gtcctggcccagaaccagagcaccgagaccaggatgtcgctgcactcgggcctgtggcgg
gtctgcttcctggcaggtgaggagcaggggcgttgcttcaccatcgagtacgtgatgccc
gcgagcgcccagctgacctcggagtccacggtcagcgtactaaaaatgattcgctcggcc
accccgttccccctggtcagcctcttcttcatgttcatcggcttcatcctgagcaacatc
ggacacgtccgtccccacaggaccatcctggcctttgtctcaggcatcttctttatcctc
tcgggcctctccctcgtggtgggcctggtgctctacatctccagcatcaacgacgagatg
ctcaacaggaccagggacacggagacctacttcagctacaagtatggctggtccttcgcc
ttcgcagccatctccttcctgttaaccgagagcgccggggtgatgtccgtgtacctgttc
atgaagaggtataccgccgaggacctgtaccggcctcaccccggcttctaccgcccgcgt
ctgagcaactgctcagattactcgggccagttcctgcacccggacgcctgggcccggggc
cgcagtccctccgacctctccagcgacgcctccctgcagatgaacagcagctacccggcg
ctgctcaagtgcccagactacgaccagatgtccacctccccgtgctga

DBGET integrated database retrieval system