KEGG   Bos taurus (cow): 529488Help
Entry
529488            CDS       T01008                                 

Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
bta  Bos taurus (cow)
Pathway
bta00250  Alanine, aspartate and glutamate metabolism
bta00410  beta-Alanine metabolism
bta00430  Taurine and hypotaurine metabolism
bta00650  Butanoate metabolism
bta01100  Metabolic pathways
bta04727  GABAergic synapse
bta04940  Type I diabetes mellitus
Module
bta_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    529488
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    529488
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    529488
   00430 Taurine and hypotaurine metabolism
    529488
 Organismal Systems
  Nervous system
   04727 GABAergic synapse
    529488
 Human Diseases
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    529488
Enzymes [BR:bta01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     529488
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase SepSecS
Motif
Other DBs
NCBI-GeneID: 529488
NCBI-ProteinID: XP_024840294
BGD-bta: BT13502
Ensembl: ENSBTAG00000000531
LinkDB All DBs
Position
24
AA seq 590 aa AA seqDB search
MPRHKACCNTHAEPPRRRQHTVMCQSVPRGLRERVTMEVVSQRPLGVSESLYYFYQVPLF
TSVSGEVHWEEFRVASSGWVVLLFSQENRPCLFLFSLDLLPSKEGEDLTKCFLLRVVNIL
LHYIEKTFDDKSKILDFHHPHQLLEGLDGFDLELSDHPESLEQLLVDCTDTLKYGVKTGH
PRYFNQLSSGLDVIGLAGEWLTATANTNMFTYEIAPVFTVMETVLLKKMCGIIGWRETEA
DGIFSPGGSISNLYGILVARYKQYPEIKARGMAVLPCIVLFVSEQGHYSIKKAAATLGIG
TDNVIEVKCDERGKMIPAELEKNILQAKRKGQTPFCVVATAGSTVFGAFDPLHDIADICE
THKLWMHVDAAWGGGLLLSRKHSCKLSGIERADSVTWNPHKLMGVPLQCSAVLTREKGLL
GACNQMQAEYLFQPDKVYNINFDTGDKTIQCGRHVDVFKLWLMWKAKGTYGFEVQIDRYM
ELAKYFYKVLKKKDNFKLVFDAEPEFTNVCFWYFPPRLKHIPKSFERDQELQKIAPKIKA
QMIVEGTAMLSYQPCGDKVNFFRMVFSNPATRQTDVDYLIDEIQRLGKDL
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgccccgacacaaagcctgttgcaacacgcacgcagagccaccccggagacgccagcac
acagtgatgtgtcagagcgtgccacgcggattgcgagagcgcgtcacgatggaggtggtg
tcacagcgccccctgggagtctcagaaagtctttattatttttatcaagttccccttttc
accagcgtctcaggagaagtccactgggaagagttccgagtggcttcgtctggatgggtg
gtgctgctctttagtcaggaaaaccgaccttgtttatttcttttttctctagatttgttg
ccatccaaggagggcgaagatttaacaaaatgttttctgctgcgagtggtaaatattctt
ctgcactacattgagaaaactttcgatgataagagtaaaatattggactttcatcatcct
catcaacttcttgaaggtttggatgggtttgacttagaactgtctgaccatcctgaatct
ctggagcagttgctggttgattgcacagacaccttaaaatatggggtaaaaacaggacat
cctcgctattttaaccagctctccagtgggctagatgtgatcggacttgcaggggaatgg
ttgacagccactgcaaataccaacatgtttacctatgaaatagctccagtatttactgtc
atggaaacagttcttcttaagaaaatgtgtggaattattggctggagagaaacagaagca
gatggaatattttcacctggtgggagtatatcaaacctctatggtatattagtagctcgt
tataagcaatatccagagataaaagcaagaggcatggcagtccttccgtgcatcgtattg
tttgtttctgaacaaggtcattattccataaaaaaggctgcagcaactcttggtattggg
acagataatgtaattgaagtaaaatgtgatgaaaggggaaagatgattccagctgagtta
gagaaaaatatattacaagctaaaagaaagggccagactcctttctgtgttgtggccaca
gctggcagcaccgtgttcggggccttcgacccgctccatgacatcgcagatatttgtgag
acacacaagctctggatgcatgtggatgcagcttggggaggtggattgctgttgtccaga
aagcattcctgtaaactcagtggcattgaaagggccgactccgtgacctggaacccccac
aaactcatgggtgtgccccttcagtgctctgctgtcctgacccgggaaaaaggtcttctg
ggagcgtgcaaccagatgcaggctgaatacctcttccagcctgataaagtctacaatatt
aactttgacaccggggataagacgattcaatgcggccgacatgtcgatgtctttaagctc
tggttaatgtggaaggcaaagggaacctatgggtttgaggtacagattgacagatatatg
gaacttgcaaaatacttctataaagttttaaagaaaaaagataactttaagcttgtattt
gacgcagagcctgagttcacgaatgtctgcttctggtatttcccaccaagacttaaacat
atcccaaaaagttttgaaagagatcaagaactgcaaaagattgctccgaagattaaagct
cagatgatagtggagggtacagccatgctcagctaccagccctgtggggacaaagtaaat
tttttccgaatggtcttttctaatcctgccacaagacaaacagatgttgactatcttatt
gatgaaattcaaagacttgggaaagatttatga

DBGET integrated database retrieval system