KEGG   Bos taurus (cow): 530330Help
Entry
530330            CDS       T01008                                 

Gene name
GANC
Definition
(RefSeq) neutral alpha-glucosidase C isoform X1
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
bta  Bos taurus (cow)
Pathway
bta00052  Galactose metabolism
bta00500  Starch and sucrose metabolism
bta01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    530330 (GANC)
   00500 Starch and sucrose metabolism
    530330 (GANC)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     530330 (GANC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110 Zfx_Zfy_act
Motif
Other DBs
NCBI-GeneID: 530330
NCBI-ProteinID: XP_002690873
BGD-bta: BT14851
Ensembl: ENSBTAG00000008866
VGNC: 29246
LinkDB All DBs
Position
10
AA seq 914 aa AA seqDB search
MESAEKEEISVEDEAVDKNVFKDCSKIAFYRRQKQLLSKKSTYRALLDSVTPGEDSARFQ
IINEPAKVPLLAEVCGIEGNIFRLKINEEIPLKPRYEVPDVLTSKLTTVRLTSCPGDTGS
LVLASGKGDLKCHITANPFKVDLVSEEEVVMSINSLGQLYFEQLQIPPKQRATKKNEEDA
SIDTTQENQEELGLWEEKFENFVDVKVNGPASIGLDFSLHGFEHLYGIPQHAESHQLKNT
SDSDAYRLYNLDVYGYKIHDKMGIYGSVPYLLAHKLGRTLGIFWLNASETLVEIKTEPAV
KYTLTQTGPVAAKQKVGSRTDVHWMSESGIIDVFLLTGPTPSDVFKQYSYLTGTQAMPPL
FSLGYHQCRWNYEDEQDVKAVDAGFDEHDIPYDVMWLDIEHTEGKRYFTWDKKRFPNPKR
MQDLLRSKKRKLVVISDPHVKVDPNYSVYAKAKEQGFFVRNHEGGDFEGVCWPGLSSYLD
FTNPKVRKWYSSLFAFSVYQGSTDILHIWNDMNEPSVFKGPEQTMQKNAIHHGNWEHREL
HNIYGFYQQMATTEGLIQRSKGKERPFVLTRSFFAGSQKYGAVWTGDNTAEWSHLKISIP
MLLTLSVTGISFCGADVGGFIGDPEAELLVRWYQAGAYQPFFRGHATMNTKRREPWLFGE
EHTRLIREAIRERYTLLPYWYSLFYSAHVASQPVMRPLWVEFPNELETFSVEDEYMLGGA
LLVHPVTEPKATVVDVFLPGSSEIWYDSKTFAHWKGACTVKIPVTLDAIPVFQRGGSVVP
IKTTIGRSTGFMTNSPYGLRVALSTKGSAMGEFYLDDGHSFQYLHQKQFLHRKFSFSSGV
LTNSCADERGHYPSKCVVEQILVLGLKKQPSSVTAHSADGSAQPVAFTYHATTSTLKLET
LSLNIGADWKVRVQ
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atggaatcagctgagaaagaggaaatcagtgttgaagatgaagctgtggataaaaacgtt
ttcaaagactgcagcaagattgctttctacaggcgtcagaaacagctgctctccaagaag
tctacctaccgggcattactggactcagtcacaccaggcgaagacagtgccaggttccaa
atcatcaacgaaccagcaaaggttccactcctggctgaagtttgtggcatagagggaaat
attttcagacttaaaatcaatgaagaaatacccttgaaacccaggtatgaagttcctgat
gtcctcacaagcaagctaaccactgtaaggctgacttcttgcccaggggatacaggcagt
ctggtgttggcaagtggaaaaggagatctgaagtgtcacatcacggcaaacccattcaag
gttgacttggtatctgaagaagaggttgtaatgagcataaactccctgggccaattgtac
tttgagcagctgcagattcctcccaagcaaagagctaccaagaaaaatgaggaggatgca
tcaattgacaccactcaggaaaatcaagaggaactgggcctctgggaggagaaatttgaa
aattttgtggatgtcaaagttaacggtcctgcctccattggtttggatttctctttgcat
ggttttgagcatctctatggaatcccgcaacatgctgaatcacaccaacttaaaaacaca
agtgatagtgatgcttaccgtctttataacctagatgtctatggatataaaatacatgac
aaaatgggcatttatggttcagtgccttatctcctggcccacaaactgggcagaactcta
ggcattttttggctaaatgcctcagaaacactagtggagatcaaaacagaacctgctgta
aagtacacactgacccagacgggcccagttgctgctaaacaaaaggtcgggtctcgaact
gatgtgcactggatgtcagagagtggaatcattgatgtttttctgttgacaggacctact
ccttctgatgtcttcaagcagtattcataccttacaggcacacaagccatgccccctctc
ttttctctggggtaccatcagtgccgctggaactatgaagatgagcaggatgtaaaggca
gtggatgccggatttgatgaacatgacattccttatgatgtcatgtggctggacatagag
cacacagagggcaagaggtacttcacctgggacaagaaaagattcccaaaccccaaaagg
atgcaagatctgctcaggagcaaaaaacgtaagcttgtggtcattagtgacccccacgtc
aaggttgatcccaactactcagtgtatgctaaggccaaagaacagggcttctttgtgagg
aatcatgaaggaggagactttgaaggtgtatgctggcctggtctctcctcttacctggat
ttcaccaaccccaaagtcagaaagtggtattctagtcttttcgctttctctgtttatcag
ggatctactgacatcctccacatatggaacgacatgaatgagccctctgtctttaaaggc
ccagagcaaaccatgcagaagaatgccattcatcacggcaactgggagcaccgggaactt
cacaacatctatggcttttatcagcaaatggccactacagaaggactgatccagcgatct
aaaggaaaggagagaccctttgttcttacacgttcattctttgctggatcacaaaaatat
ggtgctgtgtggacaggtgataacacggcagagtggagtcacctgaaaatttctatccct
atgttacttaccctcagcgtgactgggatctctttttgtggagcggatgtaggtggcttc
atcggggatccagaggcagagctgctagtgcggtggtaccaggcaggagcctaccagccc
ttcttccgtggccatgccaccatgaacaccaagcgacgggagccctggctctttggggag
gagcacacccggctcatccgagaagccatcagagagcgctacaccctcctgccctactgg
tattctctgttctactctgcacacgtggcttctcaacctgtcatgaggcctctgtgggta
gagttccctaatgaattagagacttttagtgtggaagatgaatacatgctgggaggtgct
ttattggttcatccagtcacagaaccaaaagctactgttgttgatgtgtttctgccaggg
tcaagtgagatttggtatgactctaagacatttgctcactggaaaggagcgtgtacagta
aagatcccagtaaccttggacgctataccagtgtttcaacgtggtggaagtgtggtacca
ataaagaccactataggaagatccacaggcttcatgactaattccccatatggactccga
gtcgctctaagcactaagggttctgccatgggtgaattctatctcgatgatgggcattct
ttccaatacctccaccagaagcaattcttgcacaggaagttttcattttcctcaggtgtt
ttgaccaacagttgtgctgacgagaggggtcattatcccagcaagtgtgtggtggagcag
atcttggtcctaggcctcaagaagcagccatcttctgtgactgcccactcagctgatggc
agcgctcagcctgtggcttttacgtaccatgccacaacatccaccctaaagctggagacg
ctctcgctgaacattggtgcggactggaaggtgcgcgtccagtga

DBGET integrated database retrieval system