KEGG   Bos taurus (cow): 531398Help
Entry
531398            CDS       T01008                                 

Gene name
OGDHL
Definition
(RefSeq) 2-oxoglutarate dehydrogenase-like, mitochondrial
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
bta  Bos taurus (cow)
Pathway
bta00020  Citrate cycle (TCA cycle)
bta00310  Lysine degradation
bta00380  Tryptophan metabolism
bta01100  Metabolic pathways
bta01200  Carbon metabolism
Module
bta_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bta_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bta_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    531398 (OGDHL)
  09105 Amino acid metabolism
   00310 Lysine degradation
    531398 (OGDHL)
   00380 Tryptophan metabolism
    531398 (OGDHL)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     531398 (OGDHL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N GGA_N-GAT
Motif
Other DBs
NCBI-GeneID: 531398
NCBI-ProteinID: NP_001179635
BGD-bta: BT29051
Ensembl: ENSBTAG00000021728
VGNC: 32407
UniProt: F1MWG1
LinkDB All DBs
Position
28
AA seq 1010 aa AA seqDB search
MSQLRLLPSRLGTQASRLLAPHGVQRFSWCSRSSGPPAPFASSRAGGGSSYMEEMYFAWL
ENPQSVHKSWDSFFRKASEEASYSLAQPQPLSVVSEKRLAASSRTKTSKLVEDHLAVQSL
IRAYQIRGHHVAQLDPLGILDADLDSFVPSDLITTVDKLAFYDLQEADLDKEFQLPTTTF
IGGSENTLSLREIIRRLESTYCQHIGLEFMFINDVEQCQWIRQKFESPGVMQFSSEEKRT
LLARLVRSMRFEDFLARKWSSEKRFGLEGCEVMIPALKTIIDKSSEMGIENVILGMPHRG
RLNVLANVIRKDLEQIFCQFDPKLEAADEGSGDVKYHLGMYHERINRVTNRNITLSLVAN
PSHLEAVDPVVQGKTKAEQFYRGDAQGKKVMSILVHGDAAFAGQGVVYETFHLSDLPSYT
TNGTVHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNADDPEAVIYVCSVAAEW
RNTFNKDVVVDLVCYRRRGHNEMDEPMFTQPLMYKQIHRQVPVLKKYADKLIAEGTVTLQ
EFEEEIAKYDRICEEAYGKSKDKKILHIKHWLDSPWPGFFNMDGEPKSMTCPATGVPEDT
LTHIGEVASSVPLEDFKIHVGLSRILRGRADMTRKRTVDWALAEYMAFGSLLKEGIHVRL
SGQDVERGTFSHRHHVLHDQDIDRRTCVPMNHLWPDQAPYTVCNSSLSEYGVLGFELGYA
MASPNALVLWEAQFGDFHNTAQCIIDQFISTGQAKWVRHNGIVLLLPHGMEGMGPEHSSA
RPERFLQMSNDDSDAYPAFTQDFEVRQLYDCNWIVVNCSTPASYFHVLRRQILLPFRKPL
IIFTPKSLLRHPEAKSSFDQMVSGTSFQRVIPEDGAAARAPGQVRRLIFCTGKVFYDLVK
ERSSQGLDELVAITRLEQISPFPFDLIQREAEKYPGVQLVWCQEEHKNMGYYDYISPRFR
AVLGRARPVWYVGRDPAAAPATGNRNTHLVSLKKFLDTAFNLQAFEGKTF
NT seq 3033 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagctgaggctgctgccatcccggcttgggacacaggcctcaaggctcctggcc
ccacatggagtccagaggttcagctggtgcagcaggtcatctgggccaccagctcccttc
gcaagcagcagagctggaggtggttccagttatatggaggagatgtacttcgcctggttg
gaaaacccccagagtgttcacaagtcctgggacagcttcttccggaaagccagtgaggaa
gcctcttacagcctggctcagccccagcccctttctgtcgtctctgaaaagagactggca
gcatccagccggaccaagaccagtaaactggtggaagaccacctggctgtgcagtccctg
atccgggcctaccagatccggggccaccatgtggcccagctggaccccctgggcatcctg
gatgcggacctggactccttcgtgccctcagacttaatcaccaccgtcgataaactcgcc
ttctacgacctgcaggaggctgacctggataaggagttccagctgcccacaaccactttt
attggaggctccgaaaacaccctttctctgcgggagatcataaggcgcctggagagcaca
tactgccagcacattggtctggagttcatgttcatcaacgatgttgagcagtgccagtgg
atccggcagaagttcgagagcccgggcgtgatgcagttctccagcgaggagaagcggacc
ctgctagcccggctagtgcgctccatgaggtttgaagacttcctggccaggaagtggtct
tctgagaagcggtttggcctggagggctgtgaggtcatgattccggccctgaagactatc
atcgacaaatccagtgagatggggatcgagaacgtcatcctggggatgccccacaggggc
aggctgaatgtgctggccaacgttattcgcaaggacctggagcagatcttctgccagttt
gatcccaagctggaggcggcggacgagggctccggagatgtcaaatatcacctcggcatg
taccacgagcggatcaatcgtgtcacgaacaggaatatcactctgtcgctcgtggccaac
ccctcccacctggaagctgtggaccccgtggtgcaggggaagacgaaggcggagcagttc
taccgcggggacgcccagggcaagaaggtcatgtccatcctggtccacggggacgccgcc
tttgctggccagggcgtggtctatgagaccttccacctgagcgatctgccctcttacacc
accaacggtaccgtgcatgttgtcgtcaacaaccagattggcttcaccacggacccccgg
atggcccgctcctccccgtaccccaccgacgtggcccgcgtggtcaatgcacccatcttc
catgtgaacgcagacgacccagaggctgtgatatatgtgtgcagcgtggcagccgagtgg
aggaacaccttcaataaagacgtcgtggtagacctggtctgttaccgccggcgtggccac
aacgagatggacgagcccatgttcacgcagcctctcatgtacaagcagatccacagacag
gtgcccgtgctgaagaagtacgcggacaagctcatcgctgagggcacggtcaccctgcag
gagtttgaggaagaaatcgccaaatatgatcggatctgtgaggaggcgtatggcaagtcc
aaggataaaaaaatcctgcacataaagcactggcttgactctccctggcctggcttcttc
aacatggatggggagcccaagagcatgacgtgcccagccacaggtgttcctgaggacacg
ctgacccacattggtgaagtggccagctctgtgcccctggaggactttaagatccacgtg
ggcctctctcgaatcctgcggggccgtgcagacatgaccaggaagaggacggtggactgg
gcgctggcagagtacatggccttcggctccctgctcaaggagggcatccacgtgcggctc
agtgggcaggacgtggagaggggcacgttcagccaccggcaccacgttctccacgatcag
gacatcgaccggaggacgtgtgtcccgatgaaccacctgtggcctgaccaggccccctac
accgtgtgcaacagctccctctcggagtacggagtcctgggtttcgagctgggctacgcc
atggccagccccaatgccttggtcctctgggaggctcagtttggtgacttccacaacacg
gcccagtgcatcatcgaccagttcatcagcacgggtcaggccaagtgggtgcgacacaat
ggcatcgtgctgctgctgccccatggcatggagggcatgggcccagagcactcttcagcc
aggcctgagaggttcctgcagatgagcaatgacgactcagatgcctaccctgcattcacc
caggactttgaggtgagacagctctacgactgcaactggatcgtggttaactgctccacg
ccggccagttacttccacgtgctgcgccggcagatcctgctgcccttccgcaagccgctg
atcatcttcacacccaaatctctgctgaggcacccagaggccaagtccagctttgaccag
atggtatctggaaccagtttccagcgggtgattcctgaggatggggctgcggcgcgggct
cctgggcaggtgcggcggctcatcttctgcacgggcaaggtgttctatgacctggtgaag
gagcggagcagccagggcctggacgagctcgtggccatcacacgcctggagcagatctct
ccgtttcctttcgacctgatccagcgagaggcagagaagtacccgggcgtgcagctggtg
tggtgccaggaggagcacaagaacatgggctactacgactacatcagcccccgcttcagg
gccgtcctgggccgggcgcggcccgtatggtatgttggccgagacccagcggctgcacca
gccacggggaacaggaacactcatctggtgtctctgaagaagtttctggatactgccttc
aatctccaggcctttgaaggcaaaacattttag

DBGET integrated database retrieval system