KEGG   Bos taurus (cow): 532622Help
Entry
532622            CDS       T01008                                 

Gene name
KMT5A
Definition
(RefSeq) N-lysine methyltransferase KMT5A
  KO
K11428  histone-lysine N-methyltransferase SETD8 [EC:2.1.1.43]
Organism
bta  Bos taurus (cow)
Pathway
bta00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    532622 (KMT5A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bta03036]
    532622 (KMT5A)
Enzymes [BR:bta01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     532622 (KMT5A)
Chromosome and associated proteins [BR:bta03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     532622 (KMT5A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 532622
NCBI-ProteinID: NP_001039795
BGD-bta: BT11335
Ensembl: ENSBTAG00000000139
UniProt: Q2YDJ8
LinkDB All DBs
Position
17
AA seq 352 aa AA seqDB search
MARGRKMSKPRAVEAAAAAAAVAATAPGPEMVERRGPGRPRTNGENVFTGQSKIYTYMSP
NKCSGMRSPLQEENSVAQYEVKCQGKPLAGIYRKRDEKRNSGNAIRSSMKAEEQKIKDAR
RGPLAPFPNQKSEAAEPPKTPTSSCDTPNAAAAKQGLKKPVRGKQAPRKKAQGKTQQNRK
LTDFYPVRRSSRKSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGE
FVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHS
KCGNCQTKLHDIDGVPHLILIASRDIEAGEELLYDYGDRSRASIEAYPWLKH
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggctagaggcaggaagatgtccaagccccgcgcggtggaggcggcggcggcggcggcg
gcggtggcagcgacggccccgggcccggagatggtggagcggaggggcccggggaggccc
cgcaccaacggggagaatgtatttaccgggcaatcaaagatctatacctacatgagcccg
aacaaatgctctggaatgcgttccccccttcaggaagagaactcagttgcacaatacgaa
gtcaaatgccaggggaagccattagccggaatctacaggaaacgcgacgagaaaagaaac
tctgggaatgcaatacgaagctccatgaaggccgaggaacagaagatcaaagacgccagg
agaggtcccctggcaccttttccaaaccaaaaatctgaagctgcagaacctcccaaaacc
ccaacctcgtcttgtgatactcccaatgcagccgctgccaagcagggcctgaaaaagcct
gtgaggggcaaacaggcccccaggaaaaaagctcaaggaaaaacacagcagaatcgcaag
ctcacagatttctaccctgtgcgaaggagctcaaggaagagcaaggctgagctgcagtct
gaagaaaggaaaagaatagatgagttgattgaaagcgggaaggaagaaggaatgaagatc
gacctcatcgacggcaaaggcaggggcgtcatcgccaccaagcagttctcccggggtgag
tttgtggtggaataccacggggacctcatcgagatcaccgacgccaagaagcgggaggct
ctgtacgcacaagacccctccacgggctgctacatgtactattttcagtatctgagcaaa
acctactgcgtggatgcaacccgagagacaaatcgcctgggaagactgatcaatcacagt
aaatgtgggaactgccaaaccaaactgcacgacatcgacggcgtgcctcacctcatcctc
atcgcctcccgtgacatcgaggccggggaggagcttctgtatgactatggggaccgcagc
cgggcttccattgaagcctacccctggctgaagcattaa

DBGET integrated database retrieval system