KEGG   Bos taurus (cow): 535376
Entry
535376            CDS       T01008                                 

Gene name
TGFBR2
Definition
(RefSeq) TGF-beta receptor type-2 precursor
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
bta  Bos taurus (cow)
Pathway
bta04010  MAPK signaling pathway
bta04060  Cytokine-cytokine receptor interaction
bta04068  FoxO signaling pathway
bta04144  Endocytosis
bta04218  Cellular senescence
bta04350  TGF-beta signaling pathway
bta04380  Osteoclast differentiation
bta04390  Hippo signaling pathway
bta04520  Adherens junction
bta04659  Th17 cell differentiation
bta04926  Relaxin signaling pathway
bta04933  AGE-RAGE signaling pathway in diabetic complications
bta05142  Chagas disease
bta05161  Hepatitis B
bta05166  Human T-cell leukemia virus 1 infection
bta05200  Pathways in cancer
bta05202  Transcriptional misregulation in cancer
bta05210  Colorectal cancer
bta05212  Pancreatic cancer
bta05220  Chronic myeloid leukemia
bta05225  Hepatocellular carcinoma
bta05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    535376 (TGFBR2)
   04350 TGF-beta signaling pathway
    535376 (TGFBR2)
   04390 Hippo signaling pathway
    535376 (TGFBR2)
   04068 FoxO signaling pathway
    535376 (TGFBR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    535376 (TGFBR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    535376 (TGFBR2)
  09143 Cell growth and death
   04218 Cellular senescence
    535376 (TGFBR2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    535376 (TGFBR2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    535376 (TGFBR2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    535376 (TGFBR2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    535376 (TGFBR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    535376 (TGFBR2)
   05202 Transcriptional misregulation in cancer
    535376 (TGFBR2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    535376 (TGFBR2)
   05212 Pancreatic cancer
    535376 (TGFBR2)
   05225 Hepatocellular carcinoma
    535376 (TGFBR2)
   05226 Gastric cancer
    535376 (TGFBR2)
   05220 Chronic myeloid leukemia
    535376 (TGFBR2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    535376 (TGFBR2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    535376 (TGFBR2)
   05161 Hepatitis B
    535376 (TGFBR2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    535376 (TGFBR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bta01001]
    535376 (TGFBR2)
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     535376 (TGFBR2)
Protein kinases [BR:bta01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   535376 (TGFBR2)
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase Pkinase_fungal APH
Other DBs
NCBI-GeneID: 535376
NCBI-ProteinID: NP_001153038
BGD-bta: BT12096
Ensembl: ENSBTAG00000019832
VGNC: 35805
UniProt: E1B702
LinkDB
Position
22
AA seq 567 aa
MGRGLLGGLWPLHVVLWTRIASTIPPHVPKSVNSDMMVTDHNGAIKLSQLCKFCDVRSST
CDNQKSCWSNCSITAICEKPEEVCVAVWRKNDENITLETVCHDPKIAYHGFVLDDAASSK
CIMKERKGSGETFFMCSCSSEECNDHIIFSEEYTSSNPDLLLVIFQVTGVSLLPPLGIAI
AVIITFYCYRIHRQQKLSPAWDSGKPRKLMEFSEHLAIILEDDRSDISSTCANNINHNTE
LLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVAVKIFPYEEYASWKTEKDIFSDINLK
HENILQFLTAEERKTELGKQYWLITAFHAKGNLQEYLTRHVISWEDLRRLGGSLARGIAH
LHSDHTLCGRPKMPIVHRDLKSSNILVKGDLTCCLCDFGLSLRLDPTLSVDDLANSGQVG
TARYMAPEVLESRMNLENVESFKQTDVYSMALVLWEMTSRCNAVGEVKDYEPPFGSKVRE
HPCVESMKDNVLRDRGRPEIPSSWLNHQGIQTVCETLAECWDHDPEARLTAQCVAERFSE
LEHLDRLSGRSSSEEKIPEDGSLNTTK
NT seq 1704 nt   +upstreamnt  +downstreamnt
atgggccgggggctgctcgggggcctgtggccgctgcacgtcgtcctgtggacgcgcatc
gccagcacgatcccgccgcacgttcccaagtcggttaacagcgatatgatggtcactgac
cacaacggcgccatcaagctgtcgcagctgtgtaagttctgcgacgtgcggtcgtccacc
tgtgacaaccagaagtcctgctggagcaactgcagcatcacggccatctgcgagaagccg
gaggaggtctgcgtggctgtctggaggaagaatgatgagaacatcacgctggagacagtc
tgccatgaccccaagattgcctaccatggatttgtcctggacgatgctgcttcttcaaag
tgtatcatgaaggaaagaaaggggtccggagagactttcttcatgtgctcctgcagctcc
gaagaatgcaatgaccacattatcttctccgaagagtacaccagcagtaaccccgacttg
ctgctggttatcttccaagtgacaggcgtcagcctcctgccaccgctgggcatcgccatc
gcagtcatcatcactttctactgctaccgcatccaccggcagcagaagctgagcccagcc
tgggactcgggcaagccgcgcaagctgatggagttcagtgagcacctggccatcatcctg
gaggacgaccgctccgacatcagctccacctgcgccaacaacatcaaccacaacacggag
ctgctgcccatcgagctggacaccctggtgggcaaggggcgcttcgccgaggtctacaag
gccaagctgaagcagaacacgtctgagcagttcgagaccgtggccgtcaagatcttcccc
tacgaggagtatgcctcctggaagacggagaaggacatcttctcggacatcaacctcaag
cacgagaacatcctgcagttcctgacggccgaggagcgcaagacggagctgggcaagcag
tactggctcatcactgccttccacgccaagggcaacctgcaggagtacctgacgcgccac
gtcatcagctgggaggacctgcgccggctgggcggctcgctggcccgcggcatcgcgcac
ctgcacagcgaccacaccctgtgcggccggcccaagatgcccatcgtgcacagggacctc
aagagctccaacatcctggtcaagggcgacctcacctgctgcctctgcgacttcgggctc
tcactgcggctggaccccaccctgtcagtggatgacctggccaacagtgggcaggtggga
acggcgagatacatggctccagaggtcctcgagtccaggatgaatctggagaacgtggag
tccttcaagcagacggatgtctactccatggccctggtgctctgggagatgacgtctcgc
tgcaacgcagtgggagaagtgaaggactatgagcctccgttcgggtctaaggtgcgggag
catccctgtgtggaaagcatgaaggacaacgtgctgagagatcgaggccgaccagagatt
cccagctcctggctcaaccaccagggcatccagacggtgtgcgagacgctggccgaatgc
tgggaccatgaccccgaggcccggctcacggcgcagtgcgtggccgagcgcttcagcgag
ctggagcacctggacaggctctccgggaggagcagctcggaggagaagatccccgaagat
ggctccctcaacactaccaaatag

DBGET integrated database retrieval system