KEGG   Bos taurus (cow): 535603
Entry
535603            CDS       T01008                                 

Gene name
ADCY3
Definition
(RefSeq) adenylate cyclase type 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
bta  Bos taurus (cow)
Pathway
bta00230  Purine metabolism
bta01100  Metabolic pathways
bta01522  Endocrine resistance
bta04015  Rap1 signaling pathway
bta04020  Calcium signaling pathway
bta04022  cGMP-PKG signaling pathway
bta04024  cAMP signaling pathway
bta04062  Chemokine signaling pathway
bta04072  Phospholipase D signaling pathway
bta04114  Oocyte meiosis
bta04211  Longevity regulating pathway
bta04213  Longevity regulating pathway - multiple species
bta04261  Adrenergic signaling in cardiomyocytes
bta04270  Vascular smooth muscle contraction
bta04371  Apelin signaling pathway
bta04540  Gap junction
bta04611  Platelet activation
bta04713  Circadian entrainment
bta04714  Thermogenesis
bta04723  Retrograde endocannabinoid signaling
bta04724  Glutamatergic synapse
bta04725  Cholinergic synapse
bta04727  GABAergic synapse
bta04740  Olfactory transduction
bta04750  Inflammatory mediator regulation of TRP channels
bta04911  Insulin secretion
bta04912  GnRH signaling pathway
bta04913  Ovarian steroidogenesis
bta04914  Progesterone-mediated oocyte maturation
bta04915  Estrogen signaling pathway
bta04916  Melanogenesis
bta04918  Thyroid hormone synthesis
bta04921  Oxytocin signaling pathway
bta04923  Regulation of lipolysis in adipocytes
bta04925  Aldosterone synthesis and secretion
bta04926  Relaxin signaling pathway
bta04927  Cortisol synthesis and secretion
bta04928  Parathyroid hormone synthesis, secretion and action
bta04934  Cushing syndrome
bta04935  Growth hormone synthesis, secretion and action
bta04962  Vasopressin-regulated water reabsorption
bta04970  Salivary secretion
bta04971  Gastric acid secretion
bta04972  Pancreatic secretion
bta04976  Bile secretion
bta05032  Morphine addiction
bta05163  Human cytomegalovirus infection
bta05166  Human T-cell leukemia virus 1 infection
bta05200  Pathways in cancer
bta05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    535603 (ADCY3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    535603 (ADCY3)
   04371 Apelin signaling pathway
    535603 (ADCY3)
   04020 Calcium signaling pathway
    535603 (ADCY3)
   04072 Phospholipase D signaling pathway
    535603 (ADCY3)
   04024 cAMP signaling pathway
    535603 (ADCY3)
   04022 cGMP-PKG signaling pathway
    535603 (ADCY3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    535603 (ADCY3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    535603 (ADCY3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    535603 (ADCY3)
   04062 Chemokine signaling pathway
    535603 (ADCY3)
  09152 Endocrine system
   04911 Insulin secretion
    535603 (ADCY3)
   04923 Regulation of lipolysis in adipocytes
    535603 (ADCY3)
   04912 GnRH signaling pathway
    535603 (ADCY3)
   04913 Ovarian steroidogenesis
    535603 (ADCY3)
   04915 Estrogen signaling pathway
    535603 (ADCY3)
   04914 Progesterone-mediated oocyte maturation
    535603 (ADCY3)
   04921 Oxytocin signaling pathway
    535603 (ADCY3)
   04926 Relaxin signaling pathway
    535603 (ADCY3)
   04935 Growth hormone synthesis, secretion and action
    535603 (ADCY3)
   04918 Thyroid hormone synthesis
    535603 (ADCY3)
   04928 Parathyroid hormone synthesis, secretion and action
    535603 (ADCY3)
   04916 Melanogenesis
    535603 (ADCY3)
   04925 Aldosterone synthesis and secretion
    535603 (ADCY3)
   04927 Cortisol synthesis and secretion
    535603 (ADCY3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    535603 (ADCY3)
   04270 Vascular smooth muscle contraction
    535603 (ADCY3)
  09154 Digestive system
   04970 Salivary secretion
    535603 (ADCY3)
   04971 Gastric acid secretion
    535603 (ADCY3)
   04972 Pancreatic secretion
    535603 (ADCY3)
   04976 Bile secretion
    535603 (ADCY3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    535603 (ADCY3)
  09156 Nervous system
   04724 Glutamatergic synapse
    535603 (ADCY3)
   04727 GABAergic synapse
    535603 (ADCY3)
   04725 Cholinergic synapse
    535603 (ADCY3)
   04723 Retrograde endocannabinoid signaling
    535603 (ADCY3)
  09157 Sensory system
   04740 Olfactory transduction
    535603 (ADCY3)
   04750 Inflammatory mediator regulation of TRP channels
    535603 (ADCY3)
  09149 Aging
   04211 Longevity regulating pathway
    535603 (ADCY3)
   04213 Longevity regulating pathway - multiple species
    535603 (ADCY3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    535603 (ADCY3)
   04714 Thermogenesis
    535603 (ADCY3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    535603 (ADCY3)
  09165 Substance dependence
   05032 Morphine addiction
    535603 (ADCY3)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    535603 (ADCY3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    535603 (ADCY3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    535603 (ADCY3)
   05163 Human cytomegalovirus infection
    535603 (ADCY3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    535603 (ADCY3)
Enzymes [BR:bta01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     535603 (ADCY3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA Peptidase_S49_N
Other DBs
NCBI-GeneID: 535603
NCBI-ProteinID: NP_001193013
BGD-bta: BT17942
Ensembl: ENSBTAG00000018705
VGNC: 25644
UniProt: F1MPC9
LinkDB
Position
11
AA seq 1145 aa
MPRTQGFSEPEYSAEYSAEYSVSLPSDPDRGVGRTHEISVRNSGSCLCLPRFMRLTFVPE
SLENLYQTYFKRQRHETLLVLVVFAALFDCYVVVMCAVVFSGDKLAPLAVAGVGLVLDII
LFVLCKKGLLPNRVTRRVVPYLLWLLISAQVFSYLGLNFSRAHAASDTVGWQAFFVFSFF
ITLPLSLSPIVIISVVSCVVHTLVLGVTVAQQQQDGLKGVQLLREILANVFLYLCAIVVG
IMSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQENLMLSILPKHVADEMLKDMKKDES
QKDQQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTGVDMRVGVHTGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMDCLKGEFDVEPGEGGSRCD
YLEEKGIETYLIIASKPEVKKTAAQNGLNGSALLNGAPPSSKPSSPALIETKESNGSIHT
SGSVSEEPEEQDAQADNPSFPNPRRRLRLQDLADRVVDASEDEHELNQLLNEALLERESA
QVVKKRNTFLLSMRFMDPEMETRYSVEKEKQSGAAFSCSCVVLLCTAVVEILIDPWLMTN
YVTFVVGEALLLILTICSLAAIFPRAFPKKLVAFSTWIDRTRWARNTWAMLAIFILVMAN
VVDMLSCLQYYTGPTNGTAEMQVEDGCVENPKYYNYVAVLSLIATIMLVQVSHMVKLTLM
LLIAGAVAVINIYAWCPIFDDYDRKRFQQHDFPMVALEKMQVFSSSGLNGTDRLPLVPSK
YSMTVMIFVMMLSFYYFSRHVEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEH
VARHFLGSKKRDEELYSQSYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDF
DSLLDNPKFRVITKIKTIGSTYMAASGVTPDVNTNGFTSSNKDEKSDKERWQHLADLADF
ALAMKDTLTNINNQSFNNFMLRIGMNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGV
MGNIQVVEETQVILREYGFRFVRRGPIFVKGKGELLTFFLKGRDKLATFPNGASITLPHQ
VVDNS
NT seq 3438 nt   +upstreamnt  +downstreamnt
atgccgaggacccagggcttctccgagcccgagtactccgcggagtactcggccgagtac
tctgtcagcctgccttcggacccggaccgcggggtgggccggacccatgaaatctctgtc
cggaactcggggtcgtgcctctgcttgcctcgcttcatgcggctgaccttcgtaccagag
tccttggagaacctgtaccagacctacttcaagaggcagcgccacgagaccctgctggtg
ctggtggtcttcgcggccctcttcgactgctatgtggtggtcatgtgcgctgtggtcttc
tctggcgacaagctggcccccctggccgtggctggggtcgggctggtgttggacatcatc
cttttcgtgctctgcaaaaaggggctgctccccaaccgggtcactcggagagtggtgccc
tacctgctgtggctgctgatatcagcccaggtcttctcctacctgggcctgaacttctcc
cgtgcccacgcggccagcgacacggtgggctggcaggccttcttcgtcttctccttcttc
atcacgctgccgctcagcctcagccccattgtcatcatctccgtggtctcctgcgtcgtg
cacacactcgtcttgggggtcactgtggcccagcagcagcaggatgggctgaagggagtg
cagttgctgagggagattctggccaacgtcttcctctacctgtgcgccatcgtcgtgggc
atcatgtcctactacatggcagaccgcaagcaccgcaaggccttcctggaggcccgccag
tctctggaggtgaagatgaacctggaggagcagagtcagcagcaggagaaccttatgctc
tccatcctgcccaagcacgtggccgacgagatgctgaaggacatgaagaaggatgagagc
cagaaggaccagcagcagttcaacaccatgtacatgtaccgccatgagaacgtcagcatc
ctctttgctgatatcgtgggcttcacccagctgtcctcagcctgcagcgcccaggagctt
gtgaagctgcttaatgagctctttgcccgcttcgacaagctggcggctaaataccaccag
ctgcggattaagatcctgggcgactgttactactgcatctgtgggctgcctgactaccgg
gaggaccacgccgtctgctccatcctcatggggctcgccatggtggaggccatctcgtat
gtgcgggagaagaccaagaccggggtggacatgcgcgtgggggtgcacacgggcaccgtg
ctggggggcgtccttggccagaaacgctggcagtacgacgtgtggtccaccgacgtcacc
gtggccaacaagatggaggctggcggcatccctgggcgtgtgcacatctcccagagcacc
atggactgcctgaaaggagagttcgacgtggagccgggcgaggggggcagtcgctgtgat
tacctggaagagaagggcattgagacctacctcatcatcgcttccaagccagaggtgaag
aagacagctgcccaaaatggcctcaacggctcggccctgctgaacggagcgccgccttcc
tcaaagcccagctcccctgccctcattgagaccaaggagtccaacgggagcattcacacc
agcggctctgtatctgaggagcccgaggagcaagatgcccaggccgacaacccctcgttc
cccaaccctcgccggaggctgcgccttcaggacctggctgatcgcgtggtggacgcctcc
gaggacgagcatgagctcaaccagctactcaacgaggcgctgctagagcgggagtctgcc
caggtagtgaagaagagaaacaccttcctcctgtccatgcggttcatggaccccgagatg
gaaacccgctactcggtggagaaggagaagcagagcggggctgccttcagctgctcctgc
gttgtcctactctgcacggctgtggtggagatcctcattgacccctggctcatgacgaac
tatgtgacctttgtggttggggaggctctgctcctgatcctgacaatctgctcgctggct
gccatctttccgcgggcctttcctaagaagctcgtggccttctctacttggattgaccgg
acgcgctgggccaggaacacctgggccatgctggccatcttcattcttgtcatggcaaac
gtggtggacatgctcagctgtctccagtactacacaggacccaccaacggcaccgcagag
atgcaggtggaggatggctgcgtggagaaccccaagtattacaactacgtggccgtgctg
tccctcatcgccaccatcatgctggtgcaggtcagccacatggtcaagctcacactcatg
ctgctcatcgcgggggccgtggctgtcatcaacatctacgcctggtgccccatctttgac
gactacgaccgcaaacgcttccagcaacacgactttccgatggtggccttagagaagatg
caggtgttttccagctcggggctcaatggcactgacaggctgcccctggtgccgtctaag
tactcgatgacagtgatgatctttgtcatgatgctgagcttttactacttctcccgccac
gtggaaaagctggcacggacactgttcttgtggaagattgaggtccacgaccagaaggaa
cgtgtctatgagatgcgacgctggaatgaagccttggtcaccaacatgctgcctgaacac
gtggcacgccatttcctggggtccaagaagagagatgaggagctgtacagccagtcttat
gatgagattggagttatgtttgcctccctgcccaattttgctgacttctacacagaggag
agcatcaataacggtggcattgagtgtctacgcttcctcaatgagatcatctcagatttt
gactctcttctggacaatcccaagttccgggtcatcaccaagatcaagaccattggtagc
acctacatggcagcttcaggagtcaccccagatgtcaacaccaatggctttaccagctcc
aacaaggacgagaagtcagacaaggagcgctggcagcacctggcagatctggccgatttt
gcgctggccatgaaggacacgctcaccaacatcaacaaccagtccttcaacaacttcatg
ctgcgcattggaatgaacaaaggaggggtcctggctggggtcattggagcccggaaacca
cactatgacatctggggcaacacagtcaacgtagccagcaggatggagtccacaggggtc
atgggcaacatccaggtggtggaagaaacccaagtcatccttcgagaatacggcttccgc
ttcgtgaggagagggcccatctttgtgaaagggaagggggaactgctaacctttttcttg
aagggccgagacaagctggccacattccctaacggcgcctcaatcacactgcctcaccag
gtggtagacaactcctga

DBGET integrated database retrieval system