KEGG   Bos taurus (cow): 536356Help
Entry
536356            CDS       T01008                                 

Gene name
TGM6
Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase 6
  KO
K05624  transglutaminase 6 [EC:2.3.2.13]
Organism
bta  Bos taurus (cow)
Brite
KEGG Orthology (KO) [BR:bta00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    536356 (TGM6)
Enzymes [BR:bta01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     536356 (TGM6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 536356
NCBI-ProteinID: XP_015329685
BGD-bta: BT18476
Ensembl: ENSBTAG00000037464
VGNC: 35813
LinkDB All DBs
Position
13
AA seq 721 aa AA seqDB search
MGNVRELGPISLCSPCPGLRVTEVDWQRLRNGTAHHTQEYPGSNLVVRRGQRFTFTLELN
RPLESEETLIFTVETGPQASEALHTKAVFQTSELERGDTWMAVKEAQTENTTTFSLASPP
NAVIGRYQLSARVSSRRKHSDRKLGEFVLLFNPWCPEDDVFLDSEEERQEYVLNDSGIIF
RGVEKRIRAQGWNFGQFEEDILNICLSILDRTPSYQDDPATDVSHRHDPVYITRAVSAMV
NSNNDRGVVQGQWQGKYGGGTSPLHWRGSVAILHKWFKGRFKPVKYGQCWVFAGVMCTVL
RCLGIATRVVSNFNSAHDTDRNLSVDKYVDSFGRTLEDLTEDSMWNFHVWNESWFARRDL
GPSYNGWQVLDATPQEESEGVFRCGPASVTAIREGDVHLAHDGPFVFAEVNADYITWLWN
EDESRERVYSDTKKIGRCISTKAVGSDSRVDITSLYKYPEGSRKERQVYSKAVKKLFSVE
ASGRRARVRRGGGRGLWHDDLLEPATKPSITGKFKVLEPPVLGHDLKLALCLTSLTSRAQ
RVQVNLSGATILYTRRPVAEILHESHTVKLGPEEEKKIPIAISYSQYKEDLTEDKKILLA
AMCLVTKGEKLLVEKDITLEDFITIKVLGPAVVGVAVAVEVMVLNPLSERVKDCSLMVEG
SGLLQGQLSIDVPSLDPQEKASVQFKITPFKSGPRQLQVDFVSPHFPDIKGFVIIHVATA
K
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatgtccgagagctgggtcccatctccctgtgctctccctgcccagggctcaga
gtcactgaggtggactggcagcggctgcgcaacggcactgcacaccacacccaggagtac
cccggctccaacctggtggtccgcaggggccagaggttcaccttcacactggagctgaac
agacccctggagagcgaggagaccctcatcttcaccgtggagacaggaccccaggcttct
gaggccctccacaccaaagccgtgttccagacatcagagctggagcggggtgacacctgg
atggcagtgaaggaggctcagacagagaacaccacgaccttcagccttgccagccctccc
aatgccgtcattggccgttaccagctgagcgccagggtttcctctcgccgcaaacatagt
gaccggaagctgggcgagtttgttctccttttcaacccatggtgcccagaggacgacgtg
ttcctggactcagaggaagagagacaagagtacgtgctcaacgacagcgggatcatcttc
cggggtgtggagaagcgcatccgagcccaaggctggaacttcgggcagtttgaggaggac
atcctgaacatctgcctctccatcctggaccgaacccctagttaccaagacgacccagcc
accgacgtgtcccaccgccatgaccccgtctacatcaccagagccgtcagcgccatggtg
aacagcaacaacgaccggggcgtggttcaaggccagtggcagggcaagtacggcggcggc
accagccctctgcactggcgtggcagcgtggccattctgcacaagtggttcaagggcagg
ttcaagcccgtcaagtacggccagtgctgggtcttcgctggagtcatgtgcacagtcctc
aggtgcttgggaatcgcgacacgggttgtgtccaactttaactcggcccatgacacggac
aggaacctgagtgtggacaagtacgtggactccttcgggcgaacgctggaagacctgaca
gaagacagcatgtggaatttccatgtctggaatgagagctggtttgcccggcgggacctg
ggcccctcttacaatggttggcaggttctggatgccaccccccaggaggagagcgaaggc
gtgttccggtgtggcccggcctccgtcaccgccatccgcgagggcgacgtgcatctggcc
cacgatggtcctttcgtgtttgcggaggtcaacgcagactacatcacctggctttggaat
gaggatgagagccgggagcgtgtgtactcagacacgaagaagatcgggcggtgcatcagc
accaaggcggtgggcagcgactcccgcgtggacatcaccagcctctacaagtatccggaa
gggtcccggaaggagaggcaggtgtacagcaaggccgtgaagaagctgttcagtgtggaa
gcctctggaaggagggcccgggtccgcagagggggcggccgtggtctctggcatgatgac
ctcctggagcctgccaccaagcccagcatcaccggcaagttcaaggtgctggagccaccg
gtgctgggtcacgacctgaagctggccctgtgcttgaccagcctcacctcccgggcccag
cgggtccaagtcaacttgagcggtgccaccatcctttacacccgcaggccagtggcagag
atcctgcacgaatcccacacagtgaagctagggccagaagaagagaaaaagatcccaatt
gcaatatcttattctcaatataaggaagacctgacagaggacaagaagatcctgttggct
gccatgtgccttgtgaccaaaggagagaagctcctggtggagaaggacattactctggag
gacttcattaccatcaaggtgcttggcccagccgtggtgggggtggcagttgcagtagaa
gtgatggtgcttaacccactctcggagagagtgaaagactgttcgctaatggtggagggc
agtggccttctccagggacagctcagcatcgatgtgcccagcctggatccccaagagaag
gcctcggtccaattcaagatcacccccttcaagagcggcccacggcagctgcaggtagac
ttcgtcagcccccacttcccggacatcaagggctttgtgatcatccacgtggccacagct
aaataa

DBGET integrated database retrieval system