KEGG   Bos taurus (cow): 537404Help
Entry
537404            CDS       T01008                                 

Gene name
SMYD1
Definition
(RefSeq) histone-lysine N-methyltransferase SMYD1
  KO
K11426  [histone H3]-lysine4/36 N-trimethyltransferase SMYD [EC:2.1.1.354 2.1.1.357]
Organism
bta  Bos taurus (cow)
Pathway
bta00310  Lysine degradation
bta01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    537404 (SMYD1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bta03036]
    537404 (SMYD1)
Enzymes [BR:bta01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     537404 (SMYD1)
    2.1.1.357  [histone H3]-lysine36 N-dimethyltransferase
     537404 (SMYD1)
Chromosome and associated proteins [BR:bta03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     537404 (SMYD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET zf-MYND
Motif
Other DBs
NCBI-GeneID: 537404
NCBI-ProteinID: NP_001076953
BGD-bta: BT17561
Ensembl: ENSBTAG00000021120
VGNC: 35042
UniProt: A3KMV0
LinkDB All DBs
Position
11
AA seq 490 aa AA seqDB search
MTIGGMENVEVFTAEGKGRGLKATKEFCAADIIFAERAYSAVVFDSLVNVVCHTCFKRQE
KLHRCGQCKFAHYCDRTCQKDAWLNHKNECSAIKRYGKVPNENIRLAARIMWRVEREGSG
LTEGCLVSVDDLQNHVEHFGEEEQKELRLDVDTFLQYWPPQSQQFSMQYISHIFGVINCN
GFTLSDQRGLQAVGVGVFPNLALVNHDCWPNCTVIFNNGNHEAVKSMFHTQMRIELRALG
KISEGEELTVSYIDFLNVSEERKKQLKRQYYFDCTCEHCQKGLKDDLFLGVKDNPKPSQE
VVKEMIQFSKDTLEKIDKARSEGLYHEVVKLCRECLQKQEPVFADTNIYTLRLLSIVSEV
LSYLQAFEEASHYARRMVDGYMKLYHHNNAQLGMAIMRAGLTNWHAGNIEVGHGMICKAY
AILLVTHGPSHPITKDLEAMRMQTEMELRMFRQNEFMYHKMREAALNNQPMQVMAEPSKE
PAPALFHKKQ
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgacaatagggggaatggagaatgtggaggtcttcactgctgagggcaaaggcagaggt
ctgaaggccacgaaggagttctgtgctgccgacatcatctttgccgagcgggcttattcc
gctgtggtttttgacagcctggtgaatgttgtgtgccacacctgcttcaagaggcaggag
aagctccaccggtgtgggcagtgcaagtttgcccactactgtgaccgcacctgccagaaa
gatgcttggctgaaccacaagaatgaatgttcggccatcaagagatatggcaaggtgccc
aacgagaacatcaggctggcggcacgcatcatgtggcgggtggagagagagggtagcggg
ctcaccgagggctgcctggtctccgtggacgacctgcagaaccacgtggagcacttcggg
gaggaggagcagaaggagctgcggctggacgtggacacgttcctgcagtactggccgccg
cagagccagcagttcagcatgcagtacatctcccatatcttcggtgtgattaattgcaat
ggtttcacactcagtgaccagcgaggcctgcaggctgtgggcgtgggcgtcttccccaac
ctggccctggtgaaccatgactgttggcccaactgcactgtcatatttaacaatggcaat
catgaggcagtgaaatccatgtttcacacccagatgagaattgagctccgagccctgggc
aaaatctcagaaggagaggagctgacggtgtcctatatcgacttccttaacgtcagtgaa
gaacgcaagaagcagctgaagagacagtactactttgactgcacgtgtgagcactgccag
aaggggctgaaggatgacctcttcctgggggtgaaagacaacccgaagccctctcaggag
gtggtgaaggagatgatacaattctccaaggatacactggaaaaaatcgacaaggctcgc
tccgagggtttgtaccacgaggttgtgaagttatgccgggagtgcctgcagaagcaggag
ccagtgtttgccgacaccaacatctacacgctgcgactgctgagcattgtttccgaggtc
ctctcctacctgcaggcctttgaggaggcctcacactacgccaggaggatggtggatggc
tacatgaagctgtaccatcacaacaatgcccagctgggcatggccatcatgcgggcaggg
ctgaccaactggcatgctggcaacattgaagtggggcatggcatgatctgcaaagcttat
gccatcctcctggtcacacatggaccctctcatcccatcaccaaggacttagaggccatg
cggatgcagacggagatggaactgcgcatgttccgccagaacgaattcatgtaccacaag
atgcgcgaggccgccctgaacaaccaacccatgcaggtcatggccgagcccagcaaagag
ccggcgccagctctgttccacaagaagcaatga

DBGET integrated database retrieval system