KEGG   Bos taurus (cow): 538496
Entry
538496            CDS       T01008                                 

Gene name
CACNG3
Definition
(RefSeq) voltage-dependent calcium channel gamma-3 subunit
  KO
K04868  voltage-dependent calcium channel gamma-3
Organism
bta  Bos taurus (cow)
Pathway
bta04010  MAPK signaling pathway
bta04260  Cardiac muscle contraction
bta04261  Adrenergic signaling in cardiomyocytes
bta04921  Oxytocin signaling pathway
bta05410  Hypertrophic cardiomyopathy
bta05412  Arrhythmogenic right ventricular cardiomyopathy
bta05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    538496 (CACNG3)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    538496 (CACNG3)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    538496 (CACNG3)
   04261 Adrenergic signaling in cardiomyocytes
    538496 (CACNG3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    538496 (CACNG3)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    538496 (CACNG3)
   05414 Dilated cardiomyopathy
    538496 (CACNG3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:bta04040]
    538496 (CACNG3)
Ion channels [BR:bta04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   538496 (CACNG3)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2
Other DBs
NCBI-GeneID: 538496
NCBI-ProteinID: NP_001071482
BGD-bta: BT15497
Ensembl: ENSBTAG00000001404
VGNC: 26688
UniProt: Q0VD05
LinkDB
Position
25
AA seq 315 aa
MRMCDRGVQMLITTVGAFAAFSLMTIAVGTDYWLYSRGVCRTKSTSDNETSRKNEEVMTH
SGLWRTCCLEGAFRGVCKKIDHFPEDADYEQDTAEYLLRAVRASSVFPILSVTLLFFGGL
CVAASEFHRSRHNVILSAGIFFVSAGLSNIIGIIVYISANAGDPGQRDSKKSYSYGWSFY
FGAFSFIIAEIVGVVAVHIYIEKHQQLRAKSHSELLKKSTFARLPPYRYRFRRRSSSRST
EPRSRDLSPISKGFHTIPSTDISMFTLSRDPSKITMGTLLNSDRDHAFLQFHNSTPKEFK
ESLHNNPANRRTTPV
NT seq 948 nt   +upstreamnt  +downstreamnt
atgaggatgtgtgacagaggagtccagatgttgatcactactgtgggagccttcgcagct
tttagtttaatgaccattgcagtgggcacggactactggttatattccagaggtgtgtgc
aggactaaatctacaagtgataatgaaaccagcaggaagaatgaagaagtaatgacccat
tccgggctgtggaggacctgctgcctagaaggggctttccgaggtgtgtgcaagaaaatt
gatcacttccccgaagatgctgactacgaacaggatacagctgagtatctcctgcgggct
gtgagggcctccagcgtcttccctatcctcagcgtcacgctgctcttcttcggcgggctc
tgcgtggcagccagcgagttccatcgcagcagacacaacgtcatcctcagcgcgggcatc
ttttttgtctctgcagggttaagcaacatcatcggcatcatagtttatatatcagccaat
gctggagaccctgggcagcgtgactccaaaaagagctactcctatggctggtccttttac
ttcggagccttctctttcatcatcgcggaaattgtgggggtcgtcgccgtgcacatctat
atagaaaagcatcagcagttacgtgccaaatcccactcggagctcctgaagaaatcgacc
ttcgctcgccttccaccctacaggtatagatttcggaggcggtcgagttcccgctccacg
gaacccagatcccgagacctgtcccccatcagcaaaggcttccacaccatcccttccact
gacatctcaatgttcaccctgtcccgggacccctcaaagatcaccatggggaccctcctc
aactccgaccgggaccacgcttttctacagttccacaactccacgcccaaagagttcaaa
gagtcgttgcataataatccggccaacaggcgcaccacgcccgtctga

DBGET integrated database retrieval system