KEGG   Bos taurus (cow): 539383Help
Entry
539383            CDS       T01008                                 

Definition
(RefSeq) alpha-amylase 2B
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
bta  Bos taurus (cow)
Pathway
bta00500  Starch and sucrose metabolism
bta01100  Metabolic pathways
bta04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    539383
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    539383
Enzymes [BR:bta01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     539383
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 539383
NCBI-ProteinID: XP_002686210
BGD-bta: BT15836
Ensembl: ENSBTAG00000024288
LinkDB All DBs
Position
3
AA seq 511 aa AA seqDB search
MKFFLLLSAIGFCWAQYDPHVKSGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPP
SENAVITDPSRPWWERYQPVSYKLCTRSGNENEFKDMVTRCNNVGVRIYVDAVINHMTGS
GVSAGTGSTCGSYFNPGSEDFPAVPYSGWDFNDGKCKTGSGDIESYNDAYQVRDCRLVSL
LDLALEKDYVRSTIANYLNHLIDIGVAGFRIDASKHMWPGDIKAVLDKLHNLNTKWFPSG
SKPFIYQEVIDLGGEAITSSEYFGNGRVTEFKYGAKLGTVIRKWSGEKMAYLKNWGEGWG
FMPSNRALVFVDNHDNQRGHGAGGASILTFWDARLYKMGVGFMLAHPYGFTRVMSSYRWT
RHFVNGKDVNDWMGPPNKNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVMFRNVVDGQP
FTNWWDNGSNQVAFGRGNKGFIVFNNDDSTLSATLQTGLPAGTYCDVISGDKSGNSCTGI
QISVSSDGKAHFSISNSAEDPFIAIHADSKL
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgaagttttttctgttgctttcagcaattgggttctgctgggctcagtatgacccacac
gtcaaatctggacggacctccattgtccatctgtttgagtggcgctgggtagatattgct
cttgaatgtgagcgatacttagcccccaaaggatttggaggggttcaggtctccccaccc
agtgaaaatgctgtgattactgacccttcacgaccttggtgggaaagataccaaccagtt
agttacaagttatgtacaagatcaggaaatgaaaatgaattcaaagacatggtgactaga
tgtaacaacgttggtgtccgtatttatgtggatgctgtaattaatcatatgactggaagt
ggtgtgagtgcgggaacaggcagtacttgtggaagttatttcaaccctggaagtgaggat
tttccagcagtcccatactctggttgggattttaatgatggaaaatgtaaaactggaagt
ggagatattgagagctataatgatgcttatcaggtccgggattgtcgtctcgttagtctt
cttgatcttgcactggagaaagattatgtgcgctccacgattgctaactatctaaaccat
ctcattgacattggtgtagcagggttccgaattgatgcttctaagcacatgtggcctgga
gacataaaggcagttttggataaactgcataatctaaacacaaagtggtttccttcagga
agtaaacctttcatttaccaggaggtaattgatctgggtggtgaggcaattacaagcagt
gagtactttggaaatggccgtgtgacagaatttaaatatggtgcaaaactaggaacagtt
attcgcaagtggagtggagagaagatggcttacttaaagaactggggagaaggctggggt
ttcatgccttctaacagggcacttgtctttgttgataaccatgacaatcagcgagggcat
ggagctgggggagcatctattcttacattctgggatgctagactgtacaaaatgggagtc
ggatttatgctcgctcatccctatggatttacacgagtaatgtcaagctaccgttggaca
agacattttgtgaatggaaaagatgttaatgattggatggggccaccaaataaaaatgga
gtaattaaagaagttactattaatccagatactacttgtggcaatgactgggtctgtgaa
catcgatggcgtcaaataaggaacatggttatgttccgtaatgtagttgatggtcaacct
tttacaaactggtgggacaatggcagcaaccaagtagcttttggaagaggaaacaaagga
ttcattgtctttaacaatgatgacagtacactatctgcaactttgcaaactggtcttcct
gctggtacatattgtgatgttatttctggagataaaagtggtaacagttgtacagggatt
caaatcagtgtttccagtgatggcaaagctcatttttctattagtaactctgctgaagat
ccatttattgcaattcatgctgattctaaattataa

DBGET integrated database retrieval system