KEGG   Bos taurus (cow): 539860Help
Entry
539860            CDS       T01008                                 

Gene name
SETD2
Definition
(RefSeq) LOW QUALITY PROTEIN: histone-lysine N-methyltransferase SETD2
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
bta  Bos taurus (cow)
Pathway
bta00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    539860 (SETD2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bta03036]
    539860 (SETD2)
Enzymes [BR:bta01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     539860 (SETD2)
Chromosome and associated proteins [BR:bta03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     539860 (SETD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRI SET WW
Motif
Other DBs
NCBI-GeneID: 539860
NCBI-ProteinID: XP_024839055
BGD-bta: BT27800
Ensembl: ENSBTAG00000002948
VGNC: 34493
LinkDB All DBs
Position
22
AA seq 2563 aa AA seqDB search
MKQQLPPQPPPKMGDFYDPEHPTPEEEENEAKIENVPKTGFIKGPMFKGVASSRFLPKGT
KTKVNLEEQGRQKVSFSFSLTKKTLQNRFLTALGNEKQNDTPNSPVVPLQVDSTPKVKTD
IGDTLSTTEESSPPKSRVELGKIHFKKHLLHVTSRPLLTATTAVASPSPPMAPLPAVRAE
STTVDSPPSSPPPPPPPPQATTPSSPAPVTEPVALPHTPVTVLMTAPVDVAARALKEPPV
TIVPESSEVDTKQDPVSNSSEEHITHSLNEQADIPSQKEDSHIGKEEETPDSSKSSLGSK
KTGSKKKSSQSEGTFLGSESDEDSVRTSSSQRSHDLKFSANIDRERDSKKSLATLKSEDL
GKSSRSKTERDDKYFSYSKLERDTRYISSRCRERERRRSRSRSRSDRGSRTSLSYSRSER
SHYYDSDRRYHRSSPYRERTRYSRAYTDSRARESSDSEDEYKKTYSRRTSSHSSSYRNLR
TSSSYSKSDRECKTESSYLETEKRGKYSSKLERESKRTSENEAMKRCCSPPNELGFRRGS
SYSKHDNNASRYKSAPSKPVSKSDKFKNSFCCTELNEETKQSHSFSLQTPCSKGSELRVI
SKIPEREKTRSPSPSNRLNDSPTFKKLDGSPVFKSEFIGHDSHDSIKEVDSLCKVKNDQL
RSYCPTELNINGSPGAESDLAAFCTSKHDTVLMSSDDSVTGSEVSPLVKTCMLSSNGFQN
INRCKEKDLDDTCMKHSKSESPFRETEPLVSPHQDQLISLPVMTMDYSKTVVKEPVEVRV
SCCKTKDSDIYCTSNDNHPSSCHSGAENIEPLVTKMSSNSFMNVHLKSKTGICDNGNLID
QHSKFACGEYKQSVGSTSSASVNHFDDLYHTPGSSCIASSLQSLPPGIKVNSLTLLQCGE
NISPVLDAVPKSKNSEFLKHAEKETVIEVGSDLPDSGRGFASWDNRHNNGLSEKCVQEAH
EEGNSLLPDRRGRPEISLDEEGGRGHAHTSDDSEVVFSSCDLNLTMEDSDGITYTLKCDS
SGHASEIVSTVHEDYSGSSESSSDESDSEDTDSDDSSIPRNRLQSVVVVPKNSTLTMEET
SPCSSRSSQSYRHYSDHWEDERLEPRRHSYEEKFESITSKACPQTEKFFFHKAAEKNSEI
SFIQPSRKQIDNHLPEIAHPQSDGVDSTSHPDIKSDPLGHSNSEETVKAKIVSQQQEELP
VYSSDDFEDVSNKSRQQTTFPNRPDSRLGKTDSSFSSCEISRVDGFRSSEELRNLGWDFS
QQEKPTTTYQQPDSSYGACGGHKYQQSAEQCSGARSHWQGNGYWDPRSASRPPGAGVVYD
RIQGQVPDSLTDDREEEENWDQRGGSHFSSQSSKFFLSLQKDKGSVQAPEISSNSIKDSL
AVNEKKDLLKNLDRNDMKDRGPLKKRRQELESDSESDGELQDRKKVRMEIEQGETAVPLG
SALVGPSCVMEDFRDPQRWKEYAKQGKMPCYFDLIEENVYLTERKKNKSHRDIKRMQCEC
TPLSKDERAQGEIACGEDCLNRLLMIECSSRCPNGDYCSNRRFQRKQHADVEVILTEKKG
WGLRAAKDLPSNTFVLEYCGEVLDHKEFKARVKEYARNKNIHYYFMALKNDEIIDATQKG
NCSRFMNHSCEPNCETQKWTVNGQLRVGFFTTKLVPSGSELTFDYQFQRYGKEAQKCFCG
SANCRGYLGGENRVSIRAAGGKMKKERSRKKDSVDGELEALMENGEGLSDKNQVLSLSRL
MVRIETLEQKLTCLKLIQNTHSQSCLKSFLERHGLSLLWIWMAELGDGRESNQKLQEEII
KTLEHLPIPTKNMLEESKVLPIIQRWSQTKTAIPQLSEGDGYSSENTSRAHTPLNTPDPS
TKLSAEADTDTPKKLMFRRLKIISENSMDSAISDATSELEGKDGKEDLDQLENVPIEEEE
EPQPQHLLVQQLPEPKVDSDVAAEASRLPTSELEADAELEHKESSGAKLDEPIAEETPSQ
DEEEGVSDVESERSQDPPDKTVDISDLATKLLDSWKDLKEVYRIPKKSQTEKESTITERG
RDAVGFRDQTVAPKTPNRSRERDPDKQTQIKEKRKRRGSLSPPSSAYERGTKRPDDRYDT
PTSKKKVRIKDRNKLSTEERRKLFEQEVAQREAQKQQQQMQNLGMTSPLPYDSLGYNAPH
HPFAGYPPGYPMQAYVDPSNPNAGKVLLPTPSMDPVCSPAAYDHSQPLVGHSTEPLAAPP
PVPVVPHVAAPVEVSSSQYVAQSDGVVHQDSNVTVLPVPAPGPVQGQNYSVWDSNQQSVS
VQQQYSPAQSQATIYYQGQACPTVYGVTSPYSQTTPPIVQSYAQPSLQYIQGQQIFTAHP
QGVVVQPTAAVTTIVAPGQPQPLQPPEMVVTNNLLDLPPPSPPKPKTIVLPPNWKTARDP
EGKIYYYHVVTRQTQWDPPTWESPGDDASLEHEAEMDLGTPTYDENPMKTSKKPKTAEAD
TSSELAKKSKEVFRKEMSQFIVQCLNPYRKPDCKVGRITTTEDFKHLARKLTHGVMNKEL
KYCKNPEDLECNENVKHKTKEYIKKYMQKFGAVYKPKEDTELE
NT seq 7692 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagcagctgccgccgcagccgcctccaaagatgggggatttctacgaccccgag
cacccaacccctgaagaagaagaaaatgaggcaaagattgaaaatgtgccgaaaacaggt
ttcatcaaaggaccaatgttcaaaggtgttgcttctagtcggtttttgcccaaaggcacc
aagacaaaagttaatttggaggaacagggacgacagaaggtgtcattcagcttcagcctt
acaaagaaaactttgcagaacaggtttctgactgcacttggcaatgaaaagcaaaatgat
actccaaattccccagttgtacctcttcaagtagactcgacccctaaagttaagacggac
attggagatacattatctactacagaagaatcttcgccaccgaaatcaagggtagaattg
ggcaaaatccattttaagaaacatctgcttcatgtaacatccaggccactgctgactgcc
accacagcagtggcatctccatctcctcccatggcaccattaccagcagtcagagcagaa
tcaacaactgtagactcgccaccctcatctccacctccaccacctccacctccccaagcc
acaacaccctcatcaccagcaccagtaacagagccagtggccttgccacacacaccagtt
acagttctgatgacagcacccgtagatgtagctgctagagccttgaaggagccaccagta
acaattgtaccagaatcatcagaagtggacactaaacaggaccctgtatctaatagttca
gaagaacacataactcacagtttgaatgagcaagcagatattccttcacaaaaagaagat
tcccatattgggaaggaagaagaaactccagatagttctaagagtagtctgggctctaaa
aaaacaggttctaagaagaaatcctcacaatctgaaggcacctttcttggttcagaatct
gatgaagattctgtacggacttcctcaagtcaaagatcgcatgatttaaaattttcagca
aacattgacagagaaagagattcaaaaaagagcttagcaactttaaaaagtgaggattta
gggaaatcttcacgatctaaaacagagagagatgataaatattttagctactcaaaactt
gaaagagatactcggtatatatcttctcgctgtagagagagagaacgaaggaggagcaga
tctcggtctagatctgacagaggctctagaactagtttatcttattctcggtcagaacga
tcccattattatgactctgatcgtcgctaccataggagttccccctatcgagaaaggact
cgctattctcgggcatatacagatagcagggcgagagagagttctgactcagaagatgag
tataagaagacatattcaaggcgcacctcatctcattcttcctcttacagaaacctaagg
acatcatcatcctattctaagtctgaccgagagtgtaaaactgagtcctcttacttagag
actgagaaaaggggaaagtattcttccaaattagaaagagaatccaaaaggacttcagaa
aatgaagcaatgaaaagatgctgttctccccccaatgaactcggattccgacgggggtca
tcatattccaagcatgataacaatgcttcccgttacaaatctgccccttcaaaacctgta
tccaagtctgataaatttaaaaattctttctgttgtacagaattgaatgaggaaaccaaa
cagtctcattcttttagtttacagactccttgttcaaaaggtagtgaattaagagtgatt
agtaaaattcctgagagagagaagactcggtctccgtctccatcaaatcgattaaatgat
tcacctacttttaaaaagctagatggatcacctgtttttaagtctgaatttataggacat
gatagccatgatagtattaaggaagtagactctttatgtaaagtgaagaatgatcaatta
agaagttattgtcccacagaattaaatataaatgggtctccaggggcagaatctgatttg
gcagcattttgcacttctaaacatgacactgttttgatgtcttctgatgatagtgtgact
ggatcagaggtatcccccttggtcaaaacatgcatgctttcatcaaatggatttcagaat
attaatagatgtaaagaaaaagacttggatgatacttgcatgaagcatagtaagtcagaa
agcccatttagagaaacagaacctctagtgtcaccacaccaagatcaactcatatctttg
ccagttatgactatggattattccaaaacagttgttaaagaaccagttgaggtgagagtt
tcttgctgtaaaaccaaagattcagatatatactgtacttcaaatgacaaccacccttct
tcatgtcattccggagctgaaaatattgagcctttagtcacgaagatgtcttcaaatagc
tttatgaatgtgcatttgaaatcaaaaacaggtatatgtgataatggaaatctaattgat
cagcactcaaaatttgcatgtggagaatataagcagagtgttggtagtactagttcagct
tctgttaatcattttgatgacttatatcatactccagggagctcatgtattgcttcatct
cttcagagtcttcccccaggaataaaagtgaacagtttaactctcttgcagtgtggagag
aatatatctccagttttggatgctgtgccgaagagtaaaaactcagagtttttaaagcat
gcagagaaagaaacagtaatagaagtaggtagtgaccttcctgattcaggaaggggattt
gcttcatgggataacaggcataataatggactgtctgagaaatgtgtgcaggaggctcac
gaagaagggaattctttattgcctgatagaagaggaagaccagagatctctttagatgaa
gaaggtggaagaggacatgcacatacttctgatgactcagaagttgtattttcttcttgt
gatttgaatttaactatggaggacagtgatggtataacatataccttaaaatgtgacagt
agtggtcatgcctcagagattgtatctactgtccatgaagattattctggttcttccgaa
agttcaagtgatgaaagtgattcagaggatacagattctgatgatagcagtattccaaga
aaccgtcttcagtctgttgtggttgtgccaaagaattctactttgaccatggaagaaact
agtccttgttcttctcggagcagtcagagttacagacactattctgatcactgggaagat
gagagattggagccaaggagacattcatatgaggaaaaatttgagagtataacaagtaaa
gcctgtcctcaaactgagaagttcttctttcataaagcagcagagaaaaattccgaaatt
tcttttatacagcccagccgaaaacagatagataatcacctgcctgaaattgctcatccg
cagagtgatggggttgatagtacaagtcatccagacataaaatccgaccctctaggtcat
tcaaattctgaggaaacagtgaaagctaaaatagtttctcagcagcaggaagagctacca
gtttattcttctgatgattttgaagatgtctcaaataagtctcggcaacagactactttt
cctaacaggccagatagtcgactgggaaaaacagactcaagtttttcttcttgtgagatc
tcccgagtggatggcttccgttcatcagaggagctcagaaacctagggtgggacttctct
caacaagaaaagcctaccaccacgtatcagcaacctgacagcagctatggagcctgcggt
ggacacaagtatcagcaaagtgcagagcagtgtagcggggcacgcagtcactggcaaggc
aacggctactgggacccaagatcagcaagtagaccgccaggagctggggtcgtgtatgat
cgaattcaagggcaggtaccagattccttaacagatgaccgagaagaggaggagaattgg
gatcaacgtggaggatctcacttttcaagtcagtccagtaaattttttctgtcccttcag
aaggacaagggttcagtgcaagcacctgaaataagcagcaattccattaaggactctttg
gctgtgaatgagaagaaagatcttctgaaaaacttagacagaaatgatatgaaagatcga
gggcctcttaaaaaaagaagacaggaattggagagtgattctgaaagtgatggtgagctt
caggacagaaagaaagttcgaatggagatagagcagggagagacagcagtgcctctcggc
tcagcgctggttgggccttcctgtgtcatggaggacttcagggacccccagcggtggaag
gaatatgccaagcaagggaagatgccttgttactttgatctgattgaagaaaatgtttat
ttaacagaaagaaagaagaataaatcccatcgggatattaagcgaatgcaatgtgagtgt
acacctctttctaaagatgaaagagctcaaggtgaaatagcatgtggggaagattgtctt
aatcgtcttctcatgattgaatgttcttctcggtgtccaaatggggattattgttccaat
agacggtttcagaggaaacagcatgcagatgtggaagtcatcctcacggaaaagaaaggc
tggggcttgagagctgctaaagaccttccttcgaacacctttgtcctggaatattgtgga
gaggtacttgatcataaagagtttaaagcccgggtaaaggagtatgcacgaaacaaaaac
atccactactatttcatggccctgaagaatgatgagataatagatgccactcagaaagga
aattgctcccggttcatgaatcacagctgtgaaccaaactgtgagactcaaaaatggact
gtgaatggacaactgagagttgggttttttactacgaaactggttccttcaggctcagag
ttaacatttgactatcagttccaaagatatgggaaagaagcacagaagtgtttctgtggg
tcagctaattgccggggttacctgggaggagagaacagagtcagcatcagagcagcagga
gggaaaatgaagaaagaacgatctcgtaagaaggattcagtggatggggagctagaagct
ttgatggagaatggcgagggtctctctgataaaaaccaagtgctcagcttatcccggcta
atggttagaattgaaactttggaacagaaacttacctgtctcaagctcatacagaacaca
cactcacagtcttgtctgaagtcctttctggaacgtcacgggctgtctttgctgtggatc
tggatggcagaactaggtgatggccgggaaagtaaccagaagcttcaggaagagattata
aagactctggaacatttacctattcctactaaaaatatgttggaggaaagcaaagtactt
cctattattcaacgttggtctcaaaccaagactgctatccctcagctgagtgaaggagac
gggtattctagtgaaaatacatcacgtgctcacacaccactcaacacacctgatccttcc
accaagctgagcgcagaagctgacacagacacccccaagaaactcatgtttcgcagactt
aaaattataagtgaaaatagcatggacagtgcgatctctgatgccaccagcgagctagaa
ggcaaggatgggaaagaggacctggaccagttagagaatgtccccatcgaagaagaggaa
gagcctcagcctcagcacctactcgtgcaacagctgcccgagcctaaagttgacagcgac
gttgctgcggaggccagcaggctccccacgtccgaactggaggctgacgctgaactagaa
cacaaagagagcagtggcgcgaaacttgacgaacctattgctgaggaaacaccatcccaa
gatgaagaggagggtgtatctgatgtggagagtgagagaagtcaggacccgccagacaaa
acagtagatataagtgatttggccaccaagctcctggacagttggaaagacctaaaggag
gtatatcgaattccgaagaaaagtcaaactgaaaaggagagcacgataaccgaacgagga
agggatgctgtaggcttcagagatcaaacagttgccccaaagactcctaacaggtcgaga
gagagagacccagacaaacaaactcaaattaaagagaaaaggaaacgaaggggctccctc
tcaccaccttcttctgcctatgagcggggaaccaaaaggccagatgacagatatgataca
ccaacttctaaaaagaaagtacgaattaaagatcgaaataaactttctacagaggagcgt
cggaagttgtttgagcaagaggtcgctcagcgggaggctcagaaacaacagcagcagatg
cagaacctgggaatgacgtctccactgccctatgactctcttggctacaatgcccctcat
cacccctttgccggctacccaccaggttatcccatgcaggcctatgtggatcccagcaat
ccgaatgctggaaaggtgctcctccccacacccagcatggaccctgtgtgttctcctgct
gcttatgatcactctcagcccttggtgggacattctacagaaccccttgctgcccctcca
cctgtgccagtggtgccacatgtggcagcccctgtggaagtttccagttcacagtatgtg
gcccagagtgacggtgtggtacaccaagactccaatgtcactgtcttgccagtgccagcc
ccaggcccagtccaaggacagaattacagtgtttgggattcaaaccaacaatccgtgagc
gtacagcagcagtactctcctgcacagtctcaagcaaccatatattaccaaggacaggct
tgtccaactgtctatggtgtgacatcaccctattcacagacaactccaccaattgtgcag
agttatgcccagccaagtcttcagtacatccagggacaacagattttcacagctcaccca
caaggagtggtggtacagccaaccgcagccgtgactacaatagttgcaccagggcagccc
cagcccttacagccacctgaaatggttgtgacaaataatctcctggatttaccaccccca
tctcctcccaaaccaaaaaccattgtcttacctcccaactggaagacagcccgagaccca
gaaggaaagatttactactaccatgtggtcaccaggcagactcagtgggatcctcctact
tgggaaagcccaggagatgatgccagccttgagcatgaagctgagatggacttgggaacc
ccaacatatgatgaaaatcccatgaagacctcaaaaaagcctaagacagcagaagcagac
acctccagtgagctggctaagaaaagcaaagaagtattcagaaaagagatgtcccagttt
atcgtccagtgcctgaacccttaccggaaacctgactgcaaagtgggaagaattaccaca
accgaagacttcaaacacctagctcgcaagctgactcatggcgttatgaataaggagctg
aagtactgtaagaaccccgaggacctggagtgcaatgagaatgtgaaacacaaaaccaag
gagtacattaagaagtacatgcagaagtttggggctgtttacaaacccaaagaggacact
gagttagagtga

DBGET integrated database retrieval system