KEGG   Bos taurus (cow): 539969
Entry
539969            CDS       T01008                                 

Gene name
CACNG7
Definition
(RefSeq) voltage-dependent calcium channel gamma-7 subunit
  KO
K04872  voltage-dependent calcium channel gamma-7
Organism
bta  Bos taurus (cow)
Pathway
bta04010  MAPK signaling pathway
bta04260  Cardiac muscle contraction
bta04261  Adrenergic signaling in cardiomyocytes
bta04921  Oxytocin signaling pathway
bta05410  Hypertrophic cardiomyopathy
bta05412  Arrhythmogenic right ventricular cardiomyopathy
bta05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    539969 (CACNG7)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    539969 (CACNG7)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    539969 (CACNG7)
   04261 Adrenergic signaling in cardiomyocytes
    539969 (CACNG7)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    539969 (CACNG7)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    539969 (CACNG7)
   05414 Dilated cardiomyopathy
    539969 (CACNG7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:bta04040]
    539969 (CACNG7)
Ion channels [BR:bta04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   539969 (CACNG7)
SSDB
Motif
Pfam: Claudin_2 PMP22_Claudin DUF716 Claudin_3 Amastin L_HMGIC_fpl Serinc DUF4064
Other DBs
NCBI-GeneID: 539969
NCBI-ProteinID: XP_024835128
Ensembl: ENSBTAG00000007506
VGNC: 26692
LinkDB
Position
18
AA seq 275 aa
MSHCSSRALTLLSSVFGACGLLLVGIAVSTDYWLYMEEGTVLPQNQTTEVKMALHAGLWR
VCFFAGREKGRCVASEYFLEPEINLVTENTENILKTVRTATPFPMVSLFLVFTAFVISNI
GHIRPQRTILAFVSGIFFILSGLSLVVGLVLYISSINDEVMNRPSSSEQYFHYRYGWSFA
FAASSFLLKEGAGVMSVYLFTKRYAEEEMYRPHPAFYRPRLSDCSDYSGQFLQPEAWRRG
RSPSDISSDVSIQMTQNYPPAIKYPDHLHISTSPC
NT seq 828 nt   +upstreamnt  +downstreamnt
atgagtcactgcagcagccgcgccctgaccctgctgagcagcgtgtttggtgcgtgcggc
ctgctgctcgtgggcatcgccgtcagcacagactactggctgtacatggaggagggaacc
gtgctgccgcagaaccagaccaccgaggtcaagatggcgctgcacgctggcctgtggcgc
gtctgcttctttgcaggccgggaaaagggtcgctgcgtggcctcagaatatttccttgaa
ccggagatcaacttggtgacggaaaacacggagaatattctgaagacagtgcgcacagcc
acccccttccctatggtcagcctcttccttgtgttcaccgccttcgtcatcagcaacatt
ggccacatccgcccccagaggaccattctggccttcgtttccggcatcttcttcatcctc
tcgggcctctccttggtggtgggcttggttctttacatttccagcatcaacgacgaggtc
atgaacaggcccagcagctcggagcagtatttccactatcgctacgggtggtcttttgcc
ttcgctgcatcctccttcctactcaaagagggagccggcgtgatgtccgtgtacttgttc
accaaacgctacgcggaggaggagatgtaccgcccgcacccggccttctaccgcccgcgt
ctcagcgactgctccgactactcgggccagtttctgcagcccgaggcgtggcgccgtggc
cgcagcccctccgacatctccagcgacgtgtctatacagatgacgcagaactaccctccc
gccatcaagtaccccgaccacctccacatctccacctcgccctgctga

DBGET integrated database retrieval system