KEGG   Bos taurus (cow): 540388
Entry
540388            CDS       T01008                                 

Gene name
TGFA
Definition
(RefSeq) protransforming growth factor alpha isoform X1
  KO
K08774  transforming growth factor, alpha
Organism
bta  Bos taurus (cow)
Pathway
bta01521  EGFR tyrosine kinase inhibitor resistance
bta04010  MAPK signaling pathway
bta04012  ErbB signaling pathway
bta04014  Ras signaling pathway
bta04151  PI3K-Akt signaling pathway
bta04915  Estrogen signaling pathway
bta05200  Pathways in cancer
bta05210  Colorectal cancer
bta05211  Renal cell carcinoma
bta05212  Pancreatic cancer
bta05214  Glioma
bta05215  Prostate cancer
bta05223  Non-small cell lung cancer
bta05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    540388 (TGFA)
   04012 ErbB signaling pathway
    540388 (TGFA)
   04014 Ras signaling pathway
    540388 (TGFA)
   04151 PI3K-Akt signaling pathway
    540388 (TGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    540388 (TGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    540388 (TGFA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    540388 (TGFA)
   05212 Pancreatic cancer
    540388 (TGFA)
   05225 Hepatocellular carcinoma
    540388 (TGFA)
   05214 Glioma
    540388 (TGFA)
   05211 Renal cell carcinoma
    540388 (TGFA)
   05215 Prostate cancer
    540388 (TGFA)
   05223 Non-small cell lung cancer
    540388 (TGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    540388 (TGFA)
SSDB
Motif
Pfam: EGF_2 EGF TMEM154
Other DBs
NCBI-GeneID: 540388
NCBI-ProteinID: XP_002691279
BGD-bta: BT23346
UniProt: F1MWF2
LinkDB
Position
11
AA seq 160 aa
MVTSAGQLALFALGIFLAVCQALENSTSALSADPPVAAAVVSHFNDCPDSHSQFCFHGTC
RFLVQEEKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVL
IHCCEVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV
NT seq 483 nt   +upstreamnt  +downstreamnt
atggtcacctcggctggacagctcgccctcttcgcgctgggtattttcttggccgtgtgc
caggccctggagaacagcacatccgccctgagtgcagacccgcccgtggctgcagctgtg
gtgtcccattttaatgactgcccagattcccacagtcagttctgcttccatggaacctgc
aggtttttggtgcaggaggagaagccagcgtgtgtctgccactctgggtacgtcggtgca
cgctgtgaacacgcagacctcctggccgtggtggctgccagccagaagaagcaggccatc
accgccttggtggtggtctccatcgtggccctggctgtcctcatcatcacatgtgtgctg
atacactgctgcgaggtccgaaaacactgtgagtggtgccgggcgctcatctgccggcat
gagaagcccagcgccctcctgaagggaaggactgcttgctgccactcagaaacagtggtc
tga

DBGET integrated database retrieval system