KEGG   Bos taurus (cow): 540786Help
Entry
540786            CDS       T01008                                 

Gene name
PTEN
Definition
(RefSeq) phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
bta  Bos taurus (cow)
Pathway
bta00562  Inositol phosphate metabolism
bta01100  Metabolic pathways
bta01521  EGFR tyrosine kinase inhibitor resistance
bta04068  FoxO signaling pathway
bta04070  Phosphatidylinositol signaling system
bta04071  Sphingolipid signaling pathway
bta04115  p53 signaling pathway
bta04140  Autophagy - animal
bta04150  mTOR signaling pathway
bta04151  PI3K-Akt signaling pathway
bta04218  Cellular senescence
bta04510  Focal adhesion
bta04931  Insulin resistance
bta05165  Human papillomavirus infection
bta05166  Human T-cell leukemia virus 1 infection
bta05200  Pathways in cancer
bta05206  MicroRNAs in cancer
bta05213  Endometrial cancer
bta05214  Glioma
bta05215  Prostate cancer
bta05218  Melanoma
bta05222  Small cell lung cancer
bta05224  Breast cancer
bta05225  Hepatocellular carcinoma
bta05230  Central carbon metabolism in cancer
bta05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    540786 (PTEN)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    540786 (PTEN)
   04070 Phosphatidylinositol signaling system
    540786 (PTEN)
   04071 Sphingolipid signaling pathway
    540786 (PTEN)
   04151 PI3K-Akt signaling pathway
    540786 (PTEN)
   04150 mTOR signaling pathway
    540786 (PTEN)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    540786 (PTEN)
  09143 Cell growth and death
   04115 p53 signaling pathway
    540786 (PTEN)
   04218 Cellular senescence
    540786 (PTEN)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    540786 (PTEN)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    540786 (PTEN)
   05206 MicroRNAs in cancer
    540786 (PTEN)
   05230 Central carbon metabolism in cancer
    540786 (PTEN)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    540786 (PTEN)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    540786 (PTEN)
   05214 Glioma
    540786 (PTEN)
   05218 Melanoma
    540786 (PTEN)
   05215 Prostate cancer
    540786 (PTEN)
   05213 Endometrial cancer
    540786 (PTEN)
   05224 Breast cancer
    540786 (PTEN)
   05222 Small cell lung cancer
    540786 (PTEN)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    540786 (PTEN)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    540786 (PTEN)
   05165 Human papillomavirus infection
    540786 (PTEN)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    540786 (PTEN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bta01009]
    540786 (PTEN)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     540786 (PTEN)
    3.1.3.48  protein-tyrosine-phosphatase
     540786 (PTEN)
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     540786 (PTEN)
Protein phosphatases and associated proteins [BR:bta01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    540786 (PTEN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase Y_phosphatase3 PTPlike_phytase DUF3256
Motif
Other DBs
NCBI-GeneID: 540786
NCBI-ProteinID: NP_001306827
BGD-bta: BT13900
Ensembl: ENSBTAG00000009498
VGNC: 33496
UniProt: A0A024QYS0
LinkDB All DBs
Position
26
AA seq 573 aa AA seqDB search
MERGGEAAAAAAAAAPGRGPESPVTISRAGNAGELVSPLLLPPTRRRRRRHIQGPGPVLN
LPSAAAAPPLARAPEAAGGGSRSEDYSSPHSAAAAARPLAAEEKQAQSLQPSSSRRSSHY
PAAVQSQAAAERGASATAKSRAISILQKKPRHQQLLPSLSSFFFSHRLPDMTAIIKEIVS
RNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKHKNHYKIYNL
CAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVAAIHCKAGKGR
TGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYLLKNHLDYRP
VALLFHKMMFETIPMFSGGTCNPQFVVCQLKVKIYSSNSGPTRREDKFMYFEFPQPLPVC
GDIKVEFFHKQNKMLKKDKMFHFWVNTFFIPGPEETSEKVENGSLCDQEIDSICSIERAD
NDKEYLVLTLTKNDLDKANKDKANRYFSPNFKVKLYFTKTVEESSNPEASSSTSVTPDVS
DNEPDHYRYSDTTDSDPENEPFDEDQHTQITKV
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
ctggagcgggggggagaagcggcggcggcggcggcggccgcagctccggggagggggccg
gagtcgcctgtcaccatttccagggctgggaacgccggagagttggtctctccccttcta
ctgcctccaacacggcggcggcggcggcggcacatccagggacccgggccggttttaaac
ctcccctccgccgccgccgcaccccccctggcccgggctccggaggccgccggaggaggc
agccgttccgaggattattcttctccccattccgctgccgccgctgccagacccctggct
gctgaggagaagcaggcccagtcgctgcaaccatccagcagccgccgcagcagccattac
ccggctgcggtccagagccaagcggcagcagagcgaggggcatcagccaccgccaagtcc
agagccatttccatcctgcagaagaagccccgccaccagcagcttctgccatctctctcc
tcctttttcttcagccacaggctcccagacatgacagccatcatcaaagagatcgttagc
agaaacaaaaggagatatcaagaggatggattcgacttagacttgacctatatttatcca
aacattattgctatgggctttcctgcagaaagacttgaaggtgtatacaggaacaatata
gatgatgtagtaaggtttttggattcaaagcataaaaaccattacaagatatacaatcta
tgtgctgaaagacattatgataccgccaaatttaattgcagagttgcacagtatcccttt
gaagaccataatccaccacagttagaacttatcaaacccttttgtgaagatcttgaccaa
tggctaagtgaagatgacaatcatgttgcagcaattcactgtaaagctggaaagggacga
actggtgtaatgatttgtgcatatttgttacatcggggcaaatttttaaaggcacaagag
gccctagatttctatggggaagtaaggaccagagacaaaaagggagtaactattcccagt
cagaggcgctatgtgtattattatagctacctgttaaagaatcatctggattatagacca
gtggcactgttgtttcacaagatgatgtttgaaactattccaatgttcagtggtggaact
tgcaatcctcagtttgtggtctgccagctaaaggtgaagatatattcctccaattcagga
cccacacgacgggaagacaagttcatgtactttgagttccctcagccattgcctgtgtgt
ggtgacatcaaagtagagttcttccacaaacagaacaagatgctaaaaaaggacaaaatg
tttcacttttgggtaaacacattcttcataccaggaccagaggaaacctcagaaaaagta
gaaaatggaagtctatgtgatcaagaaattgatagtatttgcagtatagagcgtgcagat
aatgacaaggaatatctagtactcactttaacaaaaaatgatctcgacaaagcaaataaa
gacaaggccaaccgatacttttctccaaattttaaggtgaagctgtacttcacaaaaaca
gtagaggagtcatcaaatccagaggctagcagttcaacttctgtaacaccagatgttagt
gacaatgaacctgatcattatagatattctgacaccactgactctgatccagagaatgaa
ccttttgatgaagatcagcatacacaaattacaaaagtctga

DBGET integrated database retrieval system