Bos taurus (cow): 613345 Help Entry 613345            CDS       T01008                                  Name (RefSeq) histone H3.3A   KO K11253   histone H3 Organism bta  Bos taurus (cow) Pathway bta04613   Neutrophil extracellular trap formation bta05034   Alcoholism bta05202   Transcriptional misregulation in cancer bta05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:bta00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     613345  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     613345   09163 Immune disease    05322 Systemic lupus erythematosus     613345   09165 Substance dependence    05034 Alcoholism     613345  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bta03036]     613345   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bta04147]     613345 Chromosome and associated proteins [BR:bta03036]  Eukaryotic type   Nucleosome assembly factors    Histones     613345 Exosome [BR:bta04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    613345 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone PAF CENP-T_C DNA_RNApol_7kD CENP-S Motif Other DBs NCBI-GeneID:  613345 NCBI-ProteinID:  XP_005205310 BGD-bta:  BT30455 Ensembl:  ENSBTAG00000045673 UniProt:  G3N2P2 LinkDB All DBs Position 4:30029323..30029848 Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTSGKAPRKQLATKAARKSAPSTGRVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQSLVREIAQDFKTDLRFQSAAIGALLEASEAYLVGLFEDTNLCAICAKRVTI MPKDIQLACRKCGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtacaaagcagactgcccgcaaatcgaccagtggtaaagcaccgaggaagcaa ctcgctacaaaagccgctcgcaagagtgcgccctctactggacgggtgaagaaacctcat cgttacaggcctggtactgtggcactccgtgaaattagacgttatcagaagtccactgaa cttctgattcgcaaacttcccttccagagtctggtgcgggaaattgctcaggacttcaaa acagatctgcgcttccagagtgcagctattggtgctttgctggaggcaagtgaggcctac ctggttggcctttttgaagacaccaacctgtgtgctatctgtgccaaacgtgtaacaatt atgccaaaagacattcagctagcatgccgcaaatgtggagaacgtgcttaa

DBGET integrated database retrieval system