KEGG   Bos taurus (cow): 613905Help
Entry
613905            CDS       T01008                                 

Gene name
GSTO2
Definition
(RefSeq) glutathione S-transferase omega-2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bta  Bos taurus (cow)
Pathway
bta00480  Glutathione metabolism
bta00980  Metabolism of xenobiotics by cytochrome P450
bta00982  Drug metabolism - cytochrome P450
bta00983  Drug metabolism - other enzymes
bta01524  Platinum drug resistance
bta05200  Pathways in cancer
bta05204  Chemical carcinogenesis
bta05225  Hepatocellular carcinoma
bta05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    613905 (GSTO2)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    613905 (GSTO2)
   00982 Drug metabolism - cytochrome P450
    613905 (GSTO2)
   00983 Drug metabolism - other enzymes
    613905 (GSTO2)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    613905 (GSTO2)
   05204 Chemical carcinogenesis
    613905 (GSTO2)
  09162 Cancers: Specific types
   05225 Hepatocellular carcinoma
    613905 (GSTO2)
  09166 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    613905 (GSTO2)
  09176 Drug resistance: Antineoplastic
   01524 Platinum drug resistance
    613905 (GSTO2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bta02000]
    613905 (GSTO2)
Enzymes [BR:bta01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     613905 (GSTO2)
Transporters [BR:bta02000]
 Other Transporters
  Pores ion channels [TC:1]
   613905 (GSTO2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 Glutaredoxin GST_C_3 GST_C
Motif
Other DBs
NCBI-GeneID: 613905
NCBI-ProteinID: NP_001193084
BGD-bta: BT26225
Ensembl: ENSBTAG00000040290
VGNC: 29687
LinkDB All DBs
Position
26
AA seq 244 aa AA seqDB search
MTDDATRTLGKGSIPPGPVPEGVIRLYSMRFCPYAHRTRLVLRAKGIRHEVININLRNKP
EWYFTKHPFGQIPVLENSKCQLIYESVIACEYLDDAYPGRKLYPYDPYERARQKMLLELF
YKVPHLTKECLVALRCGRDCGDLKLALRQEFCNLEEILGYQNTVFFGGDCISMIDYLFWP
WFERLEVYGIADCVNHTPALRLWIAAMKQDPTVCSLLTDKNTFLGFLNLYFQNNPGAFDY
GLSC
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgactgacgacgcgaccaggaccttggggaaagggagcatccccccagggccggtccct
gaaggcgtaatccgcctctacagcatgaggttctgtccctacgcgcacaggacgcgcctg
gtcctccgggccaaaggcatcagacatgaagttatcaacattaacctgagaaacaagcct
gagtggtactttacaaagcatccttttggccaaattcctgtcctggagaacagcaaatgt
caactgatctatgagtctgtcatcgcttgtgagtacctggatgacgcttaccctggaagg
aagctgtacccgtatgacccttacgagcgagctcgccaaaagatgttattggagctattc
tataaggtcccacatttgaccaaggagtgtctggtagcattgagatgcgggagagactgc
ggtgatctgaagctggccctgcgtcaggagttctgcaacctggaagagattcttggctat
cagaacaccgtcttctttggcggagattgtatatccatgattgattacctcttttggccc
tggtttgagcggctggaagtatatggaatagccgactgtgtgaaccacacccctgcgctc
cggctctggattgcagccatgaagcaggatcccacagtctgttctcttctcacagataag
aacaccttcttgggcttcttgaatctctattttcagaacaaccccggtgcctttgactac
gggctaagttgctga

DBGET integrated database retrieval system