KEGG   Bos taurus (cow): 615552Help
Entry
615552            CDS       T01008                                 

Gene name
MGST2
Definition
(RefSeq) microsomal glutathione S-transferase 2 precursor
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bta  Bos taurus (cow)
Pathway
bta00480  Glutathione metabolism
bta00980  Metabolism of xenobiotics by cytochrome P450
bta00982  Drug metabolism - cytochrome P450
bta00983  Drug metabolism - other enzymes
bta01524  Platinum drug resistance
bta05200  Pathways in cancer
bta05204  Chemical carcinogenesis
bta05225  Hepatocellular carcinoma
bta05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    615552 (MGST2)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    615552 (MGST2)
   00982 Drug metabolism - cytochrome P450
    615552 (MGST2)
   00983 Drug metabolism - other enzymes
    615552 (MGST2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    615552 (MGST2)
   05204 Chemical carcinogenesis
    615552 (MGST2)
   05225 Hepatocellular carcinoma
    615552 (MGST2)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    615552 (MGST2)
  Drug resistance
   01524 Platinum drug resistance
    615552 (MGST2)
Enzymes [BR:bta01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     615552 (MGST2)
Transporters [BR:bta02000]
 Other Transporters
  Pores ion channels [TC:1]
   615552 (MGST2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-GeneID: 615552
NCBI-ProteinID: NP_001069850
BGD-bta: BT13843
Ensembl: ENSBTAG00000021779
VGNC: 31452
UniProt: Q2KJG4
LinkDB All DBs
Position
17
AA seq 146 aa AA seqDB search
MAGNSILLAALSVLSACQQSYFAMQVGKARSKYKVTPPSVSGSPDFERIFRAQQNCVEFY
PIFIITLWMAGWYFNQVFATCLGLVYIYSRHQYFWGYAEAAKKRVTGFRLSLGVLALLTV
LGAVGILNSFLDEYLDIDIAKKLRHF
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atggcagggaattcgatattgctggctgcactctctgtcctctcagcctgtcagcaaagt
tattttgctatgcaggtaggaaaggcgagatcaaaatacaaagttacgcccccatcagtc
tctgggtcgccagattttgagagaatatttcgtgcacagcaaaactgtgtggagttttac
ccaatattcataatcacattgtggatggctggatggtatttcaaccaagtttttgctact
tgtctgggtctggtgtacatctattcccgtcaccagtatttctggggatacgcagaagct
gctaaaaaaagggtcactggtttccggctgagtctgggggttttggccttattgactgtc
ctaggtgccgtggggattttgaacagctttctggatgaatacctggacatcgatattgcc
aagaaactgaggcacttctaa

DBGET integrated database retrieval system