KEGG   Bos taurus (cow): 617674Help
Entry
617674            CDS       T01008                                 

Gene name
HTR3A
Definition
(RefSeq) 5-hydroxytryptamine receptor 3A precursor
  KO
K04819  5-hydroxytryptamine receptor 3
Organism
bta  Bos taurus (cow)
Pathway
bta04726  Serotonergic synapse
bta04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:bta00001]
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    617674 (HTR3A)
  09157 Sensory system
   04742 Taste transduction
    617674 (HTR3A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:bta04040]
    617674 (HTR3A)
Ion channels [BR:bta04040]
 Ligand-gated channels
  Serotonin (5-HT3)
   617674 (HTR3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Motif
Other DBs
NCBI-GeneID: 617674
NCBI-ProteinID: NP_001180098
BGD-bta: BT11492
Ensembl: ENSBTAG00000010791
VGNC: 29998
UniProt: F1N4Y2
LinkDB All DBs
Position
15
AA seq 484 aa AA seqDB search
MLPWLPRALLGLLLPTLLAPWGEAKHRGDPQPPNASRPALLRLSDHLLANYKKGVRPVRD
WRTPTTVSIDVIVYAILSVDEKNQVLTTYIWYRQYWTDEFLQWDPEDFDNITKLSIPTDS
IWVPDILINEFVDVGKSPNIPYVYVRHHGEVQNYKPLQVMTACTLDIYNFPFDIQNCSLT
FTSWLHTIQDINISLWRLPEKVKFDRSVFMNQGEWELLGVLTQFQEFSIESSDSYAEMKF
YVVIRRRPLFYAVSLLLPSIFLMVVDIVGFYLPPDSGERVSFKITLLLGYSVFLIIVSDT
LPATAIGTPLIGVYFVVCMALLVISLAETILIVRLVHKQDLQQPVPAWLRHLVLERVTLL
LCLGDQSTARRPAATSQAAKTDDCSDMGNHYSHLGGPRDLEKTPRGRGSPPPPPREASLA
VRGLLQELTSIRHFLEKREGSREVARDWLRVGSVLDRLLFRIYLLAVLAYSITLVTLWSI
WQYS
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgctgccctggctgccacgggcgctgctcggcttgcttctgcccacgctgctggcacca
tggggagaggccaagcacaggggggacccccagccccccaacgcctccaggccggctctg
ctgcggctgtcagatcacctgctggccaactacaagaagggcgtgcggcccgtgcgggac
tggaggacaccgaccactgtgtccatcgacgtcattgtctacgccatcctcagcgtggat
gagaagaatcaggtcctgaccacctacatctggtatcggcagtactggacagatgagttt
ctccagtgggaccctgaggactttgacaacatcaccaaattgtccatccccacagacagc
atctgggtcccagacatccttatcaatgagtttgtggacgtggggaagtctccaaacatc
ccgtatgtctatgtccggcatcacggcgaggtccagaactacaagcccctccaggtgatg
accgcctgtaccctggacatctacaacttccccttcgacatacagaactgctcgctgacc
ttcaccagctggctgcacaccatccaggacatcaacatctccctgtggcgcctgcctgaa
aaggtgaagttcgacaggagtgtcttcatgaaccagggcgagtgggagctgctgggggtg
ctgacccagtttcaggagttcagtatagaaagcagtgacagctacgcagagatgaagttc
tatgtggtcatccgccgacggcccctcttctatgcggtcagcctgcttctgcccagtatc
ttcctcatggtcgtggacattgtgggcttctatctgcctccagacagtggtgagagagtt
tccttcaagatcacgctcctcctgggctactcggtcttcctgatcatcgtgtccgacacg
ctgcctgccacggccatcggcacgccgctcatcggtgtctactttgtcgtgtgcatggct
ctcctggtgatcagcttggccgagacgatcctcattgtgcggctggtacacaaacaggac
ctgcagcagccggtgcccgcctggctgcgccacctggttcttgagagagtcaccctgctc
ctctgcctaggggaccagtcgacagcccggaggcccgcggccacctcccaggctgccaag
accgatgactgctcagacatgggaaaccactacagccatctggggggaccccgggacttg
gagaagaccccgaggggcagaggcagccctcccccgccacctcgggaggcctccctggcg
gtgcgcgggctgctgcaggagctaacctccatccggcacttcctggaaaagcgggagggg
agtcgagaggtggcccgggactggctgcgtgtgggctccgtgctggaccggctgctcttc
cgcatctacctactggcagtgctggcctacagcatcaccctggtcacactctggtccatt
tggcagtattcctga

DBGET integrated database retrieval system