KEGG   Bos taurus (cow): 767828Help
Entry
767828            CDS       T01008                                 

Gene name
KMT5B
Definition
(RefSeq) histone-lysine N-methyltransferase KMT5B
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
bta  Bos taurus (cow)
Pathway
bta00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    767828 (KMT5B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bta03036]
    767828 (KMT5B)
Enzymes [BR:bta01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     767828 (KMT5B)
Chromosome and associated proteins [BR:bta03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     767828 (KMT5B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET DUF3970
Motif
Other DBs
NCBI-GeneID: 767828
NCBI-ProteinID: NP_001070019
Ensembl: ENSBTAG00000001185
UniProt: Q29RP8
LinkDB All DBs
Position
29
AA seq 393 aa AA seqDB search
MKWLGESKNMVVNGRRHGGKLSNDHQQNQSKLQHSGKDNVKAGRNAGERRSSRCNGNSGF
EGQSRYVPSSGMSAKELCENDDLATSLVLDPYLGFQTHKMNTSAFPPRSSRHFSKSDSFS
HNNPVRFRPIKGRQEELKEVIERFKKDEHLEKAFKCLTSGEWARHYFLNKNKMQEKLFKE
HVFIYLRMFATDSGFEILPCNRYSSEQNGAKIVATKEWKRNDKIELLVGCIAELSEIEEN
MLLRHGENDFSVMYSTRKNCAQLWLGPAAFINHDCRPNCKFVSTGRDTACVKALRDIEPG
EEISCYYGDGFFGENNEFCECYTCERRGTGAFKSRVGLPAPAPVINSKYGLRETDKRLNR
LKKLGDSSKNSDSQSVSSNTDADTTQGRNDASK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggttgggagaatccaagaacatggtggtgaatggcaggagacatggaggcaag
ttgtctaatgaccatcagcagaatcaatcaaagttacagcactcgggaaaggacaacgtg
aaggctggcagaaacgcaggcgagaggaggtcgagcagatgtaatgggaactcaggcttt
gagggacagagtcgatatgtaccatcttctggaatgtctgccaaggaactctgtgaaaat
gatgacctagcgaccagtttggttcttgatccctatttaggttttcaaacacacaaaatg
aatactagcgcctttcctccgaggagctcaaggcatttttcaaaatctgacagtttttct
cacaacaaccctgtaagatttcggcctattaaaggaaggcaggaagaactcaaagaagta
attgaacgttttaagaaagatgagcacttggagaaagccttcaaatgtctgacttcagga
gaatgggcacggcactattttctcaacaagaacaaaatgcaggagaaattattcaaggaa
catgtatttatttatttgcgaatgtttgcaactgacagtggatttgaaatattgccttgt
aatagatactcttcagaacaaaatggagccaaaatagttgcaacgaaagagtggaaacga
aatgacaaaatagaattactggtgggttgtattgccgaactttcagaaattgaggagaac
atgctgcttagacatggagaaaacgacttcagtgtcatgtattccacaaggaaaaactgt
gctcagctctggcttggtcctgctgcatttataaaccatgattgcagacctaactgtaag
tttgtgtcaactggtcgagatacagcatgtgtgaaggccctaagagatattgaacctgga
gaagaaatttcttgttattatggagatgggttttttggagaaaacaatgagttctgcgag
tgttacacttgtgaaagacggggaactggtgcttttaaatccagagtgggactgcctgcg
cctgctcctgttatcaatagcaaatacggactcagagaaacagataaacgtttaaatagg
cttaaaaagttaggtgacagcagcaaaaactcagacagtcagtctgtcagctccaacact
gacgcagacaccactcagggaagaaacgacgcaagtaagtag

DBGET integrated database retrieval system