KEGG   Bos taurus (cow): 768038Help
Entry
768038            CDS       T01008                                 

Gene name
B3GALT4
Definition
(RefSeq) beta-1,3-galactosyltransferase 4 precursor
  KO
K00715  ganglioside galactosyltransferase [EC:2.4.1.62]
Organism
bta  Bos taurus (cow)
Pathway
bta00604  Glycosphingolipid biosynthesis - ganglio series
bta01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00604 Glycosphingolipid biosynthesis - ganglio series
    768038 (B3GALT4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bta01003]
    768038 (B3GALT4)
Enzymes [BR:bta01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.62  ganglioside galactosyltransferase
     768038 (B3GALT4)
Glycosyltransferases [BR:bta01003]
 Glycan extension
  Glycolipid
   768038 (B3GALT4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Galactosyl_T
Motif
Other DBs
NCBI-GeneID: 768038
NCBI-ProteinID: NP_001070565
BGD-bta: BT11778
Ensembl: ENSBTAG00000025669
VGNC: 26374
UniProt: Q2HJA3
LinkDB All DBs
Position
23
AA seq 378 aa AA seqDB search
MRPGLSRRLLLAALLLLLVWTLFGPSGLGEELLSLSLASLLPGPASPGPPLALPRLLIPN
EAACGAPGPPPFLLILVCTAPDNLNQRNAIRASWGRLREVRGLRVQTVFLLGEPGWGSRG
SDLVWESAAHGDIMQAAFQDSYRNLTLKTLSGLSWADRHCPTARYILKTDDDVFVNVPEL
VSELVRRGGRWEQWETGVGPPRKAKAGDEKWDGSPTLGSQPVPLLYLGRVHWRVQPSRSP
GGKHQVSEEQWPPSWGPFPPYASGTGYVLSASAVQLILKVASRAPLLPLEDVFVGLSARR
GGLAPTHCVKLAGATHYPLDRCCYGKFLLTSHKLDPWEMQEAWKLVGGSDAERTVPFCSW
LQGLLGILRCRLIAWLHS
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgcgccccggcttgtcccggcgcctgctcctggccgccctgctgctcctgctcgtctgg
accctctttgggccctccggcctcggggaggagctgttgagcctctccctggcctccttg
ctccccggcccggcctcgcccgggccgcccctggccctgccccgcctcctgatccccaac
gaggcggcgtgcggcgcgcccggcccccctcccttcctcctgatcctggtctgcaccgcc
ccggacaacctgaaccagagaaacgccatccgggcctcctggggccgcctgcgcgaggtc
cgcgggctcagggtgcagactgttttcctgctgggagagcccggctgggggtcgcgcggg
agcgacctggtgtgggagtcggcggcccacggggacatcatgcaggcagccttccaggac
tcctaccgcaacctcaccctcaagaccctcagcgggctgagctgggccgacagacactgc
cccacggcccgctacatcctcaagaccgacgatgatgtgttcgtcaacgtccccgaactg
gtgtcggagctggtcaggcggggaggccgctgggagcaatgggagacgggcgtggggccc
ccgagaaaggcgaaggctggagatgagaagtgggacggaagccccaccttggggagccag
ccagtgcctctcttgtacttgggtcgcgtgcattggcgggtgcagccctctcggtcaccg
ggaggcaagcaccaggtatcggaggagcagtggcctccctcctggggcccctttcccccc
tacgcctcaggtacgggctatgtgctatcagcttctgctgtgcagcttatcctgaaggtg
gccagccgggcaccccttctgcccctggaggatgtttttgtggggttaagtgcccgccga
ggaggccttgccccaacccactgtgtcaagctggctggtgccacccactaccccctggat
cggtgctgctatgggaaattccttctgacatcgcacaagttggacccctgggagatgcag
gaagcctggaagctagtgggtggctctgatgcagaaagaactgtacctttctgctcctgg
ctccaggggctcctgggcatcctgcgatgccggttaatagcttggcttcacagctga

DBGET integrated database retrieval system