KEGG   Bos taurus (cow): 784075
Entry
784075            CDS       T01008                                 

Gene name
CACNA2D4
Definition
(RefSeq) voltage-dependent calcium channel subunit alpha-2/delta-4
  KO
K04861  voltage-dependent calcium channel alpha-2/delta-4
Organism
bta  Bos taurus (cow)
Pathway
bta04010  MAPK signaling pathway
bta04260  Cardiac muscle contraction
bta04261  Adrenergic signaling in cardiomyocytes
bta04921  Oxytocin signaling pathway
bta05410  Hypertrophic cardiomyopathy
bta05412  Arrhythmogenic right ventricular cardiomyopathy
bta05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    784075 (CACNA2D4)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    784075 (CACNA2D4)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    784075 (CACNA2D4)
   04261 Adrenergic signaling in cardiomyocytes
    784075 (CACNA2D4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    784075 (CACNA2D4)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    784075 (CACNA2D4)
   05414 Dilated cardiomyopathy
    784075 (CACNA2D4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:bta04040]
    784075 (CACNA2D4)
Ion channels [BR:bta04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   784075 (CACNA2D4)
SSDB
Motif
Pfam: VWA_N VGCC_alpha2 VWA_3 VWA VWA_2 dCache_1 CobT_C
Other DBs
NCBI-GeneID: 784075
NCBI-ProteinID: XP_024848683
BGD-bta: BT21750
Ensembl: ENSBTAG00000021994
VGNC: 26682
LinkDB
Position
5
AA seq 1116 aa
MRGELAPTSETRIIPLSPIPVTWASLRKTAILLCLLSSTSLSPTRGQVRIPVETVKLWAD
TFGRDLYDTVTKYSGSLLLQKKYKDVESSLKIKEVDGLELVRKFSEDMETMLRRKVEAVQ
NLVEAAEEADLNHEFNESLVFDYYNSVLLNEKDSSGAYVELGAEFLLEANAHFSDLLVNT
TLSSVQLPTNVYNKDPDILNGIYMSEALNAVFVENFQRDPTLTWQYFGSSTGFFRIYPGI
KWTPDENGVITFDCRNRGWYIQAATSPKDIVIVVDTSGSMKGLRMTIAKHTVSTILDTLG
ENDFVNIIAYNDYIHYIEPCFKGILVQADRDNREHFKQLVDELMVKGVGVVDRALREAFQ
ILQQFQEAGQGSLCNQAIMLITDGAVEDYEPVLEKYNWPDRKVRVFTYLIGREVSFADRL
KWIACNNKGYYTQISTLADAQENVMEYLHVLSRPMVINHDHDITWTEAYIDSKVGPQGAQ
SLALLTTVAMPVFSKKNETRSHGILLGVVGSDVALRELMKLAPRYKLGVHGYAFLNTNNG
YILSHPDLRPLYREGKKLKPKPNYNSVDLSEVEWEDQAGMLRTAMINGETGSLSMDVKVP
LDRGKRVLFLTNDYFFTDISDTPFSLGVVLSRGHGEYILLGNTSVEEGLHDLLHPDLSLA
GDWIYCITDIDPEHRKLSQLEAVVRFLTQEDPALECDEELLQEALFDAVVTAPMEAYWTA
LALNSSDESEQVVDMAFLGTRAGLLRSSLFVGSEKVSDKRFLTPADEDSMFTLDHFPLWY
RQAAEHPPGSMVFNLRSAEGPESPSKPAVVTVSTAVAVSVDNRTAIAAAVGVQMRMEFLQ
RSFWAATRQCGAAEGPCPESCQDSDLDCFVVDNNGFILISERPQEVGRFLGEVDGALVTQ
LLSMGVFSQVTMYDYQAMCRPPTHHHSASEPLVSPISAILSATRWLMNELLLLLLEWRAW
GSWRGDHRAEAKTVFHHSHKHKKQDLLQPCDTAYPVFVHQTAVREANGTVECRACQKAFV
MQQVPSSNLLLLVTDRTCDCSIFPPVLREAEEVKYNASVKCDRMRSQRLRRRPDACHAFH
PEENAQDCGGASDTSASLALLLLPLWAWVLPPQLLR
NT seq 3351 nt   +upstreamnt  +downstreamnt
atgcgtggtgagctggcccccacttctgaaaccaggataatcccactgagccccatccct
gtgacctgggcctccctgcggaagacggcgatcctcctgtgtctgctgtccagcacgtcc
ctgtcccccacacgggggcaggtcaggatccctgtggaaacagtgaagctgtgggcagac
acctttggccgggacctgtatgacactgtcaccaagtactcgggctccctcctgctgcag
aagaaatacaaggacgtggagtccagtctgaagatcaaggaggtggacggcttggagctg
gtgaggaagttctcagaggacatggagaccatgctccgcaggaaagtggaggctgtccag
aatctggtggaggctgccgaggaggccgacctgaaccacgaattcaacgagtccctggtg
ttcgactattacaactccgtcctcctcaacgagaaggactcgagcggggcatatgtggag
ctgggggccgagttcctcctagaggccaacgcgcacttcagcgacctgctggtgaacacg
accctgagcagcgtgcagctgcccaccaacgtctacaacaaagacccagatatcttgaat
ggaatctacatgtccgaagctctgaacgctgtcttcgtggagaacttccagagagaccca
acgctgacctggcagtacttcggcagttccacggggttcttccgcatctacccaggcatc
aagtggacgccggatgagaacggagtcatcaccttcgactgccggaaccgtggctggtac
atacaagccgccacctccccgaaggacatcgtgatcgtggtggacacaagcggcagcatg
aaggggctgcggatgaccatcgccaagcacacggtctccaccatcctggacacgctgggg
gagaacgacttcgtgaacatcatcgcgtataatgactacatccactacatcgaaccttgt
tttaaggggatcttggtccaggcagatcgggacaaccgagagcacttcaaacagctggtg
gacgagttgatggtcaaaggtgtgggggtcgtggaccgagccctccgtgaagccttccag
atcctgcagcagttccaagaggccgggcaaggaagcctgtgcaaccaggccatcatgctg
atcaccgatggtgctgtggaagactatgagccggtgctggagaagtacaactggccagac
cgcaaggtccgggtcttcacctacctgattgggagggaagtgagttttgctgaccgcttg
aagtggatcgcctgcaacaacaaaggctactacacgcagatctccacactggcggatgcc
caggagaacgtgatggaatacctgcatgtgctcagccggcccatggtcatcaaccacgac
cacgacatcacctggaccgaagcctacatagatagcaaggtggggccccagggagcacag
agcctggcgctgctgaccaccgtggccatgcctgtcttcagcaagaagaatgagacgcgg
tcccacggcattctcctgggcgtagtgggctctgacgtggccctgagggagctgatgaag
ctggcgccccggtacaagctcggggtgcatggctatgcctttctgaacaccaacaacggc
tacatcctctcacatcctgacctccgacccctgtaccgagaggggaagaaactgaagccc
aagcccaactacaacagcgtggacctctcggaagtggagtgggaggaccaggccggaatg
ctgagaacagccatgatcaacggggagaccgggtctctctccatggatgtgaaagtcccg
ctggacagagggaagcgagttcttttcttgaccaacgactacttcttcacggacatcagt
gacacacctttcagcttgggggtggtgctgtcccgaggtcacggagaatacatcctcctg
gggaacacgtcggtggaagaaggcctgcatgacctgcttcacccagatctgagcctggcc
ggcgactggatctactgcatcacggacatcgacccagagcaccgcaagctgagccagctg
gaggctgtggtacgcttcctgacccaggaggaccccgccctggagtgtgacgaggagctg
ctgcaggaggcgctgtttgacgcggtggtcacggcccccatggaggcatactggacggca
ctggccctcaacagctccgacgagtccgagcaagtggtggacatggccttcctgggcacc
cgggctggcctcctcagaagcagcttgttcgtgggctccgagaaggtctctgacaagagg
ttcctgactccggcggacgaggacagcatgttcaccctggaccacttccctctttggtac
cgccaggccgcagagcatcctcccggcagcatggtcttcaacctccgctcggcagaagga
ccagaaagtcccagcaagcctgcggtggtgacggtgagcacagccgtagccgtgagcgtg
gacaacagaacggccatcgctgcagccgtgggcgtccagatgagaatggaattcctgcag
cgcagcttctgggctgccacccggcagtgtggtgccgcggaggggccgtgcccagagagc
tgccaggacagtgacctggactgctttgtcgtcgacaacaatgggttcatcctgatctct
gagaggccccaggaggtgggccgattcctgggggaggtagacggtgcgctcgtgacccag
ctgctcagcatgggggtgttcagccaagtgaccatgtacgactaccaggccatgtgcaga
cccccgacccaccaccacagcgcctccgagcccctggtcagccccatctctgccatcctg
tcggctaccaggtggctgatgaacgagctcctgctgctcctgctggagtggagggcctgg
ggctcctggcgtggggaccacagggctgaggccaagaccgtcttccatcattcccacaag
cacaagaagcaggacctgctgcagccctgtgacaccgcctaccccgtgttcgtccaccag
acggccgtgcgggaggccaacggcactgtggagtgccgcgcctgccagaaggcatttgtg
atgcagcaggtccccagcagcaacctcctgctcctggtgacagaccgcacctgtgactgc
agcatcttcccgccagtgctgcgggaggcggaggaggtcaaatataacgcctctgtcaag
tgcgacaggatgcgttcccagaggctccgccggcgcccggacgcctgccatgccttccat
ccagaggagaatgcccaggactgcggaggcgcctcagacacctcggcctcactcgccctg
ctcctgctgcctctgtgggcctgggtgctgccaccccagctgctgcggtga

DBGET integrated database retrieval system