KEGG   Bemisia tabaci (sweet potato whitefly): 109035248
Entry
109035248         CDS       T06019                                 

Definition
(RefSeq) adenylate cyclase type 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
btab  Bemisia tabaci (sweet potato whitefly)
Pathway
btab00230  Purine metabolism
btab01100  Metabolic pathways
btab04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:btab00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109035248
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    109035248
Enzymes [BR:btab01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     109035248
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF1053
Other DBs
NCBI-GeneID: 109035248
NCBI-ProteinID: XP_018904366
LinkDB
Position
Unknown
AA seq 1023 aa
MEAGDPDPSLERLYRSYSAKQKRAALPCFIFAAFAYDVYALTLPSFEPLVTCAFIVLWCV
VLVWTRFREHRVAPHVASSLFLFQVLLHLALQPHGLSPRDSFGWVLLLDFLIYVALPLPL
RFCLLFSVIACILYFILVVFFAKSEPYLLQQLLADAVLLINANILGAFCYGISDKQQRTA
FLGTRQCLEMKLVIEEQSAEQERLLLSVLPEHVAVKMRQDLGSGLDSQFKKIYMSRHENV
SILYADIVGFTAISSTYSASELVKILNELFATFDRLSERYEQLRIKILGDCYYCISGAPR
ERPDHAILSVYMGLSMVKAIKYVQQKTNSPVDMRVGIHTGAVLAGVLGQRQWQFDVYSKD
VELANKMESSGLPGRVHVSEKTLSFLDGAFEVEPAYGEKREETLRLAGIKTYFIVEPKKA
YQSVRNGVITDINEALEKDNFECTSPDDETSSAQRVRENSENFKKRLKKDLMNKDGQREL
SNHISPWTLRFRDTDKEKDYNQQKEASSNVSILVCPIVLVCTFIAQTMILPRDALSFSSF
GVGFILIIIFTSIIIADILPAIFPNKLVKWSESLNSVLWARRLIVIVVVIVLGSTNLIDS
LSCLPEHVPGNCTRSEPADSCVFPSYFTHMCALVLIATALLGQLCYLTKAILLYAITVAH
SSFNIFVINKALYCEEYQTISNFNYLLPTQYTISEQLLGVMAALAILGHYMEKASRVLYL
WKIEAESQQERASDIRRRNEALVYNILPPHVATHFLGNRKRQHEELYSQSYAEVGVLFAS
MPNFSDFYSEETVNNQGLECLRFLNEVISDFDALLEQPQYQDIIKIKTIGSTYMAASGLN
PTRKVLADDPIEIRWAHLSLLVEFALDLKKALQSINEQSFNHFVLKMGINHGPITAGVIG
ARKPHYDIWGNSVNVASRMESTGKAGCIQVTQETSEILQHFGYKFEQRGLVAVKGKGQLM
TYYLIGRQTSQLCMEPKMETLKEEDEEELEGETEETQVHLSLADSEKEALLADKPPEPNE
ETT
NT seq 3072 nt   +upstreamnt  +downstreamnt
atggaggcgggagatccggacccgtcgctcgagcgactctacaggagctacagcgccaaa
cagaagcgcgccgctttgccatgcttcatcttcgccgcgttcgcctacgacgtctacgcg
ctcaccttgcccagcttcgagccgctggtcacctgtgctttcatcgtgttgtggtgtgtt
gtcctcgtctggactcgcttccgggagcaccgtgtcgccccccacgtggcctccagcctc
ttcctcttccaagtccttcttcatctcgccctccagccccacggcctcagccctcgcgac
tccttcggctgggtcctcctccttgacttcctcatttatgtcgccctccctttgccactc
cgcttttgtctcctcttcagtgtcatcgcctgcatcttgtattttattctagtcgtgttt
tttgccaaatcggagccctatcttcttcagcagttgctggcagatgctgtgttactcata
aatgcaaacattctaggagcattttgctacgggatctcggataaacaacaacggacggca
ttcttggggactcgacaatgtttggaaatgaaactagtcatagaggaacaatctgcagag
caggaaagattgcttctgtccgtgttaccggagcatgtagctgtaaaaatgaggcaagac
ttagggtctggactcgacagtcaattcaaaaaaatttacatgagccgccatgaaaacgta
agcatcctgtacgctgacatcgttggattcacggcaatttcatccacttactcagcttcg
gaactcgttaaaatattgaacgaactctttgccaccttcgaccggctgtctgagaggtac
gaacaattaagaataaaaatcttgggtgactgctactactgcatcagtggtgctcccagg
gagaggccagaccatgctattctcagcgtttacatggggctctccatggtgaaagctatc
aagtacgtgcaacagaaaaccaactctccagtggacatgcgggtgggcattcatactgga
gccgtcctggccggggttttgggtcaacgacagtggcagttcgatgtttattccaaggac
gtggagctcgctaataagatggagagcagcggtcttccagggcgagttcatgtctctgag
aaaactttaagctttttggacggagctttcgaagtggagccggcttatggggagaagcgg
gaagaaactttacgcttagccggaattaaaacgtatttcatcgtcgagccgaagaaagca
tatcaaagtgtgcggaacggtgtgataactgacattaatgaggcgctggagaaagataac
tttgagtgcactagtccagatgatgaaacgagtagtgctcaaagagttcgagaaaactcg
gaaaatttcaagaagcggctgaaaaaagatctcatgaacaaagatgggcaaagagaacta
agcaatcacatttctccgtggacccttcgcttcagggacaccgacaaagaaaaagattac
aaccagcaaaaggaagcatcatccaatgtttccattttagtctgccccattgttttagtc
tgcacatttattgcacaaacaatgattttgccaagggacgcgttaagtttctcatcattt
ggcgtaggatttattttaattattatttttactagtattataatagctgatattttaccg
gcgatatttccaaacaaactggtaaaatggagcgaatctttaaatagcgttttatgggcc
cgaaggctgattgttattgttgttgttattgttctaggatcaactaatttaatagactct
ttatcgtgtttacctgaacatgttccggggaattgcacaaggtccgaaccagcagatagc
tgtgtctttccctcgtattttacgcacatgtgtgctcttgtgctcatcgcgactgctctt
ctaggacagttgtgttacctgaccaaggcaatcttattgtatgcaataaccgtcgctcat
tcctctttcaacattttcgtgatcaataaagcactctattgtgaggagtaccaaacaata
tccaattttaattatttactgccaacacaatacactatttcggagcaactattgggtgtt
atggctgctttggcaatattaggccattatatggagaaggcgtccagagtgctgtacctg
tggaaaatcgaagcagagagccagcaagagagggcctcggatattcgacgtcgaaacgag
gctctcgtctacaatattttaccgccgcacgtagcaacgcatttcctcggaaacaggaaa
cggcagcacgaagaactctacagtcagagctacgctgaggtcggcgtcctcttcgcctca
atgcccaacttctcagatttttactctgaggagacggttaacaaccagggtttagaatgt
ttaagatttttaaacgaagttatatctgacttcgacgcgctgttggagcaaccgcaatac
caggatataattaaaattaagacgataggatctacctacatggctgcaagtggtttgaac
ccaacgagaaaagtcctggctgacgatccgatcgaaattaggtgggcacacttatcttta
cttgtggagtttgctttggatttgaagaaagcattacagagcataaatgaacagagcttc
aatcattttgttttaaaaatgggtataaaccatggtccaatcacagccggagttatagga
gcaagaaagcctcattatgatatttggggcaattcggtgaatgttgcttcaaggatggag
agtacaggcaaagctggttgcatccaagtcactcaagagacctcggaaattttgcaacat
ttcggttacaagttcgagcaacgagggctggtggcggtcaaagggaaggggcagctcatg
acgtactacttaatcgggaggcaaacgagccagttgtgcatggagccgaaaatggagacg
cttaaagaagaggacgaagaggaactcgaaggagagacggaagagacgcaagttcacctt
tcattggccgactcggagaaagaggcgctcctcgcggacaaaccgcccgaaccaaacgaa
gaaacgacgtag

DBGET integrated database retrieval system