KEGG   Bemisia tabaci (sweet potato whitefly): 109036566Help
Entry
109036566         CDS       T06019                                 

Definition
(RefSeq) sorbitol dehydrogenase-like
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
btab  Bemisia tabaci (sweet potato whitefly)
Pathway
btab00040  Pentose and glucuronate interconversions
btab00051  Fructose and mannose metabolism
btab01100  Metabolic pathways
Module
btab_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:btab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    109036566
   00051 Fructose and mannose metabolism
    109036566
Enzymes [BR:btab01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     109036566
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_N_2 Pyr_redox 2-Hacid_dh_C PSII_Ycf12
Motif
Other DBs
NCBI-GeneID: 109036566
NCBI-ProteinID: XP_018906447
LinkDB All DBs
Position
Unknown
AA seq 352 aa AA seqDB search
MASDNLSAVLYKQNDLRLEQRPIPEPKEDEVLLQMAYVGICGSDVHYYEHGRIADFIVKD
PMVIGHEASGTVVKVGKNVKHLKKGDRVAVEPGVPCRRCQFCKEGKYNLCPDLTFCATPP
DDGNLARYYVHAADFCHKLPDNVSLEEGALLEPLSVGVHACRRAGVQLGTTVLVIGAGPI
GLVSVLAAKAYGAFVVCTARSPRRLEVAKNCGADVTLVVDPAKEEESSIIERIRSAIGDL
PNVTIDCSGNEKCITIGINITRTGGTLMLVGMGSQMVTVPLVNACAREIDIKSVFRYCND
YPIALEMVASGRCNVKQLVTHSFKLEQTVDAFEAARKKADNTIKVMISCRQG
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggcttccgacaatttgtccgctgtcctgtacaagcagaacgatcttagattggaacaa
cgaccaatcccagagcctaaggaagatgaggttttactgcagatggcatacgttggaatt
tgtggatcagatgtgcactactacgaacatggaagaatcgcagatttcattgtgaaagac
cccatggttatcggacacgaagccagtggcacagtcgtcaaagtaggcaaaaacgttaaa
catctaaagaaaggtgacagagtagcagtagagcccggtgtaccttgcaggcgatgccaa
ttttgcaaagaaggcaaatacaacctatgtcctgatctcacattctgcgccacaccccca
gatgatggaaacctagcccgatactacgtacacgccgccgatttttgccacaaattaccc
gacaatgtctctctggaggaaggtgcgttgttggaacctttgtccgtcggtgtccacgct
tgccgtcgcgcaggagtgcagttaggaacgacagttctcgttatcggagccggtcccatc
ggacttgtgtcagtcctcgccgccaaagcttacggagcattcgtcgtctgcacagctcgg
agcccgagaaggttggaggttgccaagaactgtggcgctgacgtaacactagtcgtagac
cctgccaaggaggaagaatcctctattattgagcgcattcgatcggctatcggcgatctt
cctaatgtcaccattgactgcagtggaaatgaaaaatgcatcaccataggaatcaatatt
acacgaactggtggtaccttaatgttggttggaatgggctcacaaatggtcaccgttcct
ttggtaaatgcatgcgctagggaaatcgacatcaagagtgtcttccggtattgtaatgac
tatccgatcgctcttgagatggtggcatccggacggtgtaacgtcaagcaattggtgacc
cacagcttcaagctggaacagacggtcgacgctttcgaagctgcccgcaagaaggcggac
aacaccattaaagtcatgatcagctgccgccagggttaa

DBGET integrated database retrieval system