KEGG   Bacillus thuringiensis BMB171: BMB171_C0285Help
Entry
BMB171_C0285      CDS       T01239                                 

Definition
(GenBank) hypothetical protein
  KO
K07090  uncharacterized protein
Organism
btb  Bacillus thuringiensis BMB171
Brite
KEGG Orthology (KO) [BR:btb00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BMB171_C0285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: ADH05103
LinkDB All DBs
Position
339064..339834
Genome map
AA seq 256 aa AA seqDB search
MEELSFQVIILLIAFGFLAAFIDSVVGGGGLISLPALMFVGLSPASAIATNKLAATMGTF
TSAMYFIRSGKVDFKIVGKLIPLTIVGAVAGALVVKFIPPDILRPLVLVMLVFIAIYIIA
KKNWGSVSTYKKMTQRKTLIFFFAILMIGFYDGFFGPGTGSFLIFAFLLIGLDFIQAAAS
GKLLNFVSNIVSLITFLFLDIIHFEYGIIMGLSMILGAYFGSKFAVQKGVGYVRTLFLLV
TILLIGKNVLEYTHIL
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggaagaattaagttttcaagtcattattttattaattgcattcggttttttagcagct
tttattgattccgttgttggaggaggagggttaatttcgcttcctgcgcttatgtttgtt
ggcttatcgccagcttcggcaattgcaacgaataaattagcggcaacaatggggacgttt
acgagtgcgatgtattttattcgatcaggaaaagttgattttaaaattgtaggaaagtta
atcccgttaactattgttggagctgttgcaggtgctttagtagtaaaatttattccaccg
gatattttacgcccattagtacttgtaatgttggtatttattgctatttatattattgca
aaaaagaattggggaagtgtgtctacctataagaagatgacgcaaagaaaaacattaata
tttttctttgctattttaatgataggattttatgatggattttttggaccagggacaggg
tcgtttttaatttttgcatttttattaattggcttggattttattcaagcggcagcatct
ggaaaacttttgaactttgttagtaatattgtatctttaattacttttttatttttagat
ataattcattttgaatacggtattatcatgggattatcaatgatcttaggtgcttatttt
ggatcgaagtttgcggttcaaaaaggtgttggatatgtaaggactttatttttattagtt
actatattattgatcgggaaaaatgttttggaatatactcatattttgtag

DBGET integrated database retrieval system