KEGG   Bacillus thuringiensis BMB171: BMB171_C0911Help
Entry
BMB171_C0911      CDS       T01239                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
btb  Bacillus thuringiensis BMB171
Pathway
btb00564  Glycerophospholipid metabolism
btb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:btb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BMB171_C0911 (glpD)
Enzymes [BR:btb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BMB171_C0911 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 NAD_binding_8 GIDA
Motif
Other DBs
NCBI-ProteinID: ADH05728
LinkDB All DBs
Position
1027224..1028906
Genome map
AA seq 560 aa AA seqDB search
MKFSSKQRKDVLNGVNKQELDVIVIGGGITGSGIALDGATRGLSTIVFEMQDFAAGTSSR
STKLVHGGLRYLKQLEVKMVAEVGKERAIVYENGPHVTTPEWMLLPFHTGGTFGSFSTSI
GLRVYDFLAGVKRSERRKMFNREETLNKEPLVKKEGLKGGGYYVEYRTDDARLTIEVMKE
AIEHGAKAVNYAKVDSFLYKDGKVCGVRVIDLLDGEVYEVYGKKIVNAAGPWVDTLREKD
NSKKGKVLQLSKGVHLVIDQKRFPLGQAIYFDTPDKRMVFAIPRGGKTYVGTTDTFYDKD
AAVPQMTTEDRTYIINAINYMFPSVKITEKDIESSWAGVRPLIYEEGKSASEISRKDEIW
TSESGLITIAGGKLTGYRKMAEMVVDYVTNLLQKEGHSAYPKSDTKHMPISGGHVDGSHG
FPAFVAKKAGEGTKYGLTTAQAEEFAKFYGSNVDVLFDLAKKHKDEAKEYNMPLDVLIPL
VYAMDYEMTAKPVDFFVRRRGAVFFNIHWVYEWKEAVINYMAAKLGWSKEEQMKYTAELE
KALTDAVIPVDQQEQAAALA
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgaaattttcaagtaaacaacgtaaagacgtattaaacggagtaaataaacaagagtta
gatgtgatcgtaattggtggaggtattactggttctggtattgcattagatggagcaaca
cgcgggttatcaacaattgtgtttgaaatgcaggactttgcagcaggtacatcaagtcgt
tcaacgaagcttgtacacggtggtctacgttatttaaaacaacttgaagtgaaaatggta
gcagaggtgggtaaagagcgtgcgatcgtatatgagaacggtccccatgtaacaacacca
gagtggatgttacttccgttccatacaggcggtacgttcggatcatttagtacatcaatt
ggtcttcgtgtatacgacttcttagcaggtgtaaaacgaagcgagcgcagaaagatgttt
aaccgtgaagaaacgctaaacaaagagcctcttgtaaaaaaagaaggattaaaaggcggc
ggttactacgtagaatatcgtacagatgatgcgcgtcttacaattgaagtaatgaaagaa
gcaattgagcacggcgcaaaagctgttaactacgcaaaagtagatagtttcttatataaa
gatggaaaagtatgtggtgtacgtgtaatcgatttactagacggtgaagtatatgaagtt
tacggtaagaaaattgtaaacgcagctggtccttgggtagatacacttcgtgaaaaagat
aactcgaaaaaaggaaaagtacttcagttatcaaaaggtgttcacttagtaattgatcaa
aaacgtttcccattaggtcaagcgatttacttcgatacaccagataaacgtatggtgttc
gcgattcctcgcggaggaaaaacatacgtaggtacaacagatacgttctatgataaagac
gcagctgtaccacaaatgacaacagaagatcgcacatatatcattaatgcgattaactac
atgttcccaagcgtgaaaattacagagaaagacatcgaatcaagctgggctggtgtacgt
ccgttaatttacgaagaaggtaagagtgcatctgaaatttctcgtaaagacgaaatttgg
acttctgaatctggtttaattacaatcgcaggtggtaaattaactggataccgcaaaatg
gctgaaatggtagtagactacgtaacgaacttactacaaaaagaaggtcatagcgcatat
ccgaagagcgacacgaaacatatgccaatctctggtggacatgtagatggttcacacgga
ttcccagcattcgttgcgaaaaaagctggcgaaggtacgaaatatggtttaacaacagca
caagcagaagaattcgcgaaattctacggctctaacgttgacgtactatttgatttagcg
aaaaaacataaagacgaagcgaaagaatacaacatgccactagacgttctaatcccgctt
gtatacgcaatggattacgaaatgacagcaaaaccagttgacttcttcgtacgccgtaga
ggcgctgtattcttcaatatccactgggtatacgagtggaaagaagcagtaatcaactac
atggctgcgaaactaggctggagcaaagaagaacaaatgaaatatacagctgaactagaa
aaagcattaacagacgctgtaattcctgtagatcaacaagaacaggcagctgcgttagca
taa

DBGET integrated database retrieval system