KEGG   Bacillus thuringiensis BMB171: BMB171_C1000Help
Entry
BMB171_C1000      CDS       T01239                                 

Definition
(GenBank) competence transcription factor
  KO
K02250  competence protein ComK
Organism
btb  Bacillus thuringiensis BMB171
Pathway
btb02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:btb00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BMB171_C1000
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:btb03000]
    BMB171_C1000
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:btb02044]
    BMB171_C1000
Transcription factors [BR:btb03000]
 Prokaryotic Type
  Other transcription factors
   Others
    BMB171_C1000
Secretion system [BR:btb02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) related proteins
   BMB171_C1000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ComK
Motif
Other DBs
NCBI-ProteinID: ADH05816
LinkDB All DBs
Position
1122486..1123067
Genome map
AA seq 193 aa AA seqDB search
MESKVERYVENYVVTKNTMALLPVILSEKKIVTRVVEMNDSFFVFQKPLDIIERSCRKHG
SSFLGRKEGTKELTHITHKAPIAISPADQLYFFPTYSYSRKECAWLSHFYIESNKELKDG
NLIIRFINGFAVKLEISKTSFENQQNRTAKLRTEYEDRRKKQGNPCFKEVDKKEESTLRP
AYESVYFVKEGEV
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggaaagtaaagtggaacgctatgtcgaaaattatgttgtaacgaaaaatacgatggcc
ttacttcctgttattctaagtgaaaagaaaattgttacgcgagtcgttgaaatgaatgat
tcttttttcgtatttcaaaaacctctagatattatagaaagaagttgccgcaagcatggc
tctagtttcttaggcagaaaagaaggaacgaaagagttaactcatattacacataaagca
ccgattgcgattagtccagcagatcaactttattttttccctacctattcttactctaga
aaagagtgtgcttggttgtctcatttttatattgaaagtaataaagaattaaaagatgga
aatcttattattagatttataaatggctttgctgtgaaattagagatatcaaaaactagt
tttgaaaatcaacaaaatcgtacagcgaaattacgtactgaatatgaagatcgtaggaaa
aaacaagggaatccttgttttaaagaggttgataaaaaagaggaatcaacattaagaccc
gcttatgagagtgtgtattttgtgaaggaaggcgaagtgtga

DBGET integrated database retrieval system