KEGG   Bacillus thuringiensis BMB171: BMB171_C1362Help
Entry
BMB171_C1362      CDS       T01239                                 

Definition
(GenBank) DNA polymerase
  KO
K21929  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
btb  Bacillus thuringiensis BMB171
Pathway
btb03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:btb00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    BMB171_C1362
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:btb03400]
    BMB171_C1362
Enzymes [BR:btb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     BMB171_C1362
DNA repair and recombination proteins [BR:btb03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     BMB171_C1362
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: ADH06178
LinkDB All DBs
Position
1484842..1485483
Genome map
AA seq 213 aa AA seqDB search
MKYPDHLVKQVQERSAPYQLEGFLSGQGPENPKFMLLGEAPGETEIHNGIPFSGRAGKQL
MVFLERIHVTREEVYITSAVRSRPYKWREKKERNGEIIQKKYNRTPNQGEIVAHAPLLDY
ELEKIHPKLIVTLGNIGLQRLTGKNKKITDVHGQLLKQPIQKLKDMQSAEFTWSEKEYHV
FPTFHPASIFYNRSLLELIHEDFEKLKRLVIKN
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatccagaccatttagtaaaacaagtacaagagcgtagtgctccttatcaacta
gaaggttttttaagtggacaaggtcctgaaaatcccaaatttatgttgttaggagaagca
cctggtgaaacagaaattcataatgggattccgtttagcgggagggcgggaaaacaatta
atggtttttttagagcgtatccacgttacaagggaagaagtatatattacgagcgctgtt
cggagtagaccttataaatggcgagagaaaaaagaacgaaatggtgaaatcatacaaaaa
aagtataatagaacgccaaatcagggagaaatagttgcccatgcgcctttgttagattat
gaattagagaaaatacatccgaagcttatcgtcacgcttggaaatatcggtcttcaacgt
ttaacaggaaaaaataaaaaaatcacagatgtacacgggcaattattaaaacagcccatt
caaaaattaaaggatatgcaaagtgcagagtttacatggtcagagaaagaatatcatgtt
tttccgacttttcatccagcttccattttttataatcggagtttattggagcttattcat
gaggattttgagaagcttaaaagacttgtaataaaaaactag

DBGET integrated database retrieval system