KEGG   Bacillus thuringiensis BMB171: BMB171_C1573Help
Entry
BMB171_C1573      CDS       T01239                                 

Definition
(GenBank) zinc transporter
Organism
btb  Bacillus thuringiensis BMB171
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: cobW CobW_C RsgA_GTPase GTP_EFTU T2SSE ATPase_2 MobB Viral_helicase1 TsaE AAA_14 MMR_HSR1_Xtn NACHT
Motif
Other DBs
NCBI-ProteinID: ADH06389
LinkDB All DBs
Position
complement(1677969..1679156)
Genome map
AA seq 395 aa AA seqDB search
MKKVPITVLSGFLGSGKTTLLHHILTNKNNLKVAVIVNDMSEVNIDASLIKKGGFSRTEE
KLVEIQNGCICCTLREDLMIEVNRLVENGDIDYIIIESSGISEPIPVAQTFTYTDEVLNI
DLTKNCRLDTMVTVVDANRFWDDFADGESLLDRKQAIDENDTREVIDLLIDQIEFANVII
LNKIDLLEKEDVIELHHLLKKLNPNAKVLESSFSKVPLQEILNTNLFNYEEASQSAGWIQ
ELNSDYHTPETEEYGINSFVYRRKYPFHPERLMNWLEKWPLDVVRAKGFFWLASRNNMIG
LLSQAGSSITIQGAGEWIAALPETERNQMIAEEPEVLKNWDERYGDRITELVFIGIDMNR
SVIEQLLDDCLLTEKEMGQKWNTFIDPIPAFTYTS
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtacctatcactgtattaagtggttttttaggatctggaaaaactacctta
ctacatcacattttgactaataagaataacttaaaagtagctgttatcgttaatgatatg
agcgaagtaaacattgatgcatctcttataaaaaagggtggtttttcacgtacggaggaa
aaactagtagaaattcaaaatggctgtatttgttgtacactacgagaagatttaatgata
gaagtgaatcgtcttgtggaaaatggtgatattgactatattattattgaatcttctggt
ataagtgagcctattccagttgctcaaacgtttacttatacagacgaagttcttaacatt
gatttaacgaaaaattgtcgcctcgatacgatggttacagttgtagatgcaaacagattt
tgggatgattttgcagatggagaaagtttattagaccgaaaacaagcaatcgatgagaat
gatacccgggaagttattgatttattaatagatcaaattgagtttgcaaacgtaattatt
cttaataagatagatttgctagaaaaagaagatgtgatagagcttcatcatttactaaaa
aaattaaatcctaatgcaaaagttcttgaatcttcgtttagcaaagtaccattacaagaa
attttaaacacaaatctatttaattatgaagaagccagtcaatcggccggctggatacaa
gaattaaatagtgactatcatacaccggaaacggaagaatacggtatcaattcctttgtt
taccgccgcaaatatcctttccatcccgagcgccttatgaattggctagaaaaatggcct
ttagatgttgtaagagcgaaaggattcttctggctggcatctcgtaataatatgataggg
cttctatctcaagcaggttcctctattacaattcaaggagccggtgaatggatagccgca
ttacctgaaactgaaagaaatcaaatgattgcagaagaaccagaagtattaaaaaactgg
gacgagcgatatggagatcgaataactgagctcgtatttatcggtattgatatgaatcgt
tctgtgattgaacaattattagatgattgtctattaacagaaaaggaaatgggacaaaag
tggaatacatttattgatcctattccggcttttacttatacttcataa

DBGET integrated database retrieval system