KEGG   Bacillus thuringiensis BMB171: BMB171_C1737Help
Entry
BMB171_C1737      CDS       T01239                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K01286  D-alanyl-D-alanine carboxypeptidase [EC:3.4.16.4]
Organism
btb  Bacillus thuringiensis BMB171
Brite
KEGG Orthology (KO) [BR:btb00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BMB171_C1737
Enzymes [BR:btb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BMB171_C1737
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 Beta-lactamase2 Beta-lactamase Peptidase_S13 PHA_synth_III_E DUF2362 DUF2729
Motif
Other DBs
NCBI-ProteinID: ADH06552
LinkDB All DBs
Position
1858184..1859137
Genome map
AA seq 317 aa AA seqDB search
MNRLKWGRMTVLLVIILGICWFLFQGNQKSIANVEGQPLQVAELPKAGFTEKVVPPKYIP
PEINAKAAMIIDASDGDIIYQYNENEAFAPASMSKMMTAYLLLESIHNGKVRWEDPVKMS
AKAAQTEGARIPVQVNDTLTVKDLYHALMIESANNSAVALAEHMAKSEKDFVQLMDAKAK
QLKMSEHAKFANASGLQEPDGSETKMTAGDVAQLAYHLIKDYPEILEVTHLRQSQLAFNN
INVISTNDMLNKNNKSLYIEGMDGLKTGFTDSAGYCFTGTAKQGDNRIITVVMGTSSKTK
RFTETNKLMSYAFGLVN
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaatcggttaaaatggggaaggatgacagtcctattagtcattattttagggatatgt
tggttcttattccaaggaaatcaaaagagcatagcgaatgtagagggacaacctttgcaa
gtggcagaactacctaaagcaggatttactgaaaaagtagtcccgccaaagtacatccca
ccagaaattaacgcaaaagcagctatgattatcgatgcgagtgatggagatattatttat
caatataatgaaaatgaagcttttgcaccggctagtatgtctaagatgatgacagcgtat
ctcttactagagagtatacataacgggaaagttcgctgggaagatccagtaaaaatgagt
gcgaaggcggcacaaacagagggagcgagaatcccagtacaagttaatgatacattaact
gttaaagatttatatcatgcattaatgattgagtcagctaataattcagctgtggcttta
gcagaacatatggcaaaatcggagaaagatttcgttcagcttatggatgcaaaagcgaaa
cagttaaaaatgtcggaacatgctaaatttgcaaatgcttctggattacaagagccagat
ggaagtgaaacaaaaatgacggctggtgatgtagcgcaattggcatatcatcttataaaa
gattatccggaaatattagaagtgactcacttacgccaaagtcagctagcatttaataat
attaatgttataagcacaaacgacatgttaaataaaaataataaaagtttatatatagaa
ggaatggacggactaaagactggatttacagatagtgcaggatactgttttactgggact
gcaaagcaaggtgataatcgaattattacagtggtcatggggacatcaagtaaaacaaaa
cgttttacagagacaaataagttaatgtcgtatgcatttggattagttaattaa

DBGET integrated database retrieval system