KEGG   Bacillus thuringiensis BMB171: BMB171_C3699Help
Entry
BMB171_C3699      CDS       T01239                                 

Definition
(GenBank) transaminase
  KO
K08969  aminotransferase [EC:2.6.1.-]
Organism
btb  Bacillus thuringiensis BMB171
Pathway
btb00270  Cysteine and methionine metabolism
btb01100  Metabolic pathways
Module
btb_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:btb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BMB171_C3699
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:btb01007]
    BMB171_C3699
Enzymes [BR:btb01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.-  
     BMB171_C3699
Amino acid related enzymes [BR:btb01007]
 Aminotransferase (transaminase)
  Class I
   BMB171_C3699
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Alliinase_C Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: ADH08509
LinkDB All DBs
Position
3931711..3932889
Genome map
AA seq 392 aa AA seqDB search
MKLFQPSEIVTSLPTQFFASLVAKVNKVVAAGHDVINLGQGNPDQPTPQHIVKALQDAAE
KTIHHKYPPFRGHESLKEAVATFYKREYGVELNPKTEVAILFGGKAGLVELPICFTNPGD
TILVPDPGYPDYLSGVALAKAHFERMPLIAENNFLPDYTNIDASIAERAKLMFLNYPNNP
TGATASKDFFDETIHFANKHNILVVHDFAYGAIGFDGQKPVSFLQADGAKDIGIEIYTLS
KTFNMAGWRIAFAVGNESVIETINLLQDHMYVSIFGAVQDAAREALLSSQSCVIDLVNSY
ESRRNALISACHSIGWNVDIPTGSFFAWLPVPKGYTSEQFSDILLEKAHVAVAPGVGFGE
HGEGYVRVGLLHTEDRLREAINRIDKLNFFKK
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaattatttcaaccttctgagatagtaacatcattgccaacacaatttttcgcttca
cttgttgcaaaagttaacaaagtcgttgcagctggtcacgatgttattaatctaggtcaa
ggtaatccagatcaaccaacaccgcagcatatcgtaaaagctttacaagatgctgccgaa
aagaccattcatcataaatatccgccatttcgcggacatgaaagcttaaaggaagccgtg
gctacattctataaacgtgaatatggcgtcgaattaaacccaaaaactgaagttgctatt
ttgtttggtgggaaggctggactagtagaattaccgatttgttttacaaatcctggtgat
acgattctcgttccggatccaggttatccagattatttatcaggggttgctttagcaaaa
gcacactttgaaagaatgccacttattgcagaaaataactttttaccagattatacgaac
attgatgcctctattgcagagcgtgcaaaattaatgtttttaaactatccaaataatcct
accggtgctactgcatcaaaagatttttttgatgaaaccattcactttgctaataaacat
aatatattagttgttcacgattttgcttatggcgctatcggatttgatggtcaaaaacct
gttagtttcttgcaagcagatggtgcgaaagatataggaattgaaatttacacattatca
aaaactttcaatatggctggctggcgcatcgcttttgctgtagggaatgaaagtgtgatt
gaaacaattaacctattacaagatcatatgtatgttagtatattcggtgcagttcaagat
gccgctcgagaagcgctattaagttcacagtcttgtgtaatagaccttgtaaatagttac
gaatctcgaagaaacgctcttatttcagcctgtcactcaattggttggaatgtagacatt
ccaacaggatcgttctttgcatggcttcccgttccaaaaggatacacctctgagcaattt
tctgatattttactagaaaaagcacatgtcgcagttgctcctggtgtcggatttggtgag
catggcgaagggtatgtccgtgttggtctcttgcatacagaagatagattacgagaagcc
attaatcgaattgataaattaaattttttcaaaaagtaa

DBGET integrated database retrieval system