KEGG   Bacillus thuringiensis BMB171: BMB171_C4240Help
Entry
BMB171_C4240      CDS       T01239                                 

Gene name
pyk
Definition
(GenBank) pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
btb  Bacillus thuringiensis BMB171
Pathway
btb00010  Glycolysis / Gluconeogenesis
btb00230  Purine metabolism
btb00620  Pyruvate metabolism
btb01100  Metabolic pathways
btb01110  Biosynthesis of secondary metabolites
btb01120  Microbial metabolism in diverse environments
btb01130  Biosynthesis of antibiotics
btb01200  Carbon metabolism
btb01230  Biosynthesis of amino acids
Module
btb_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
btb_M00002  Glycolysis, core module involving three-carbon compounds
btb_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
btb_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:btb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMB171_C4240 (pyk)
   00620 Pyruvate metabolism
    BMB171_C4240 (pyk)
  Nucleotide metabolism
   00230 Purine metabolism
    BMB171_C4240 (pyk)
Enzymes [BR:btb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     BMB171_C4240 (pyk)
Membrane trafficking [BR:btb04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BMB171_C4240 (pyk)
Exosome [BR:btb04147]
 Exosomal proteins
  Proteins found in most exosomes
   BMB171_C4240 (pyk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PK PK_C PEP-utilizers HpcH_HpaI Coprogen_oxidas DRTGG
Motif
Other DBs
NCBI-ProteinID: ADH09049
LinkDB All DBs
Position
complement(4455005..4456762)
Genome map
AA seq 585 aa AA seqDB search
MRKTKIVCTIGPASESIEKLEQLIEAGMNVARLNFSHGSHEEHGARIKNIREASKKTGKT
VGILLDTKGPEIRTHDFVDGQAELVTGAEVVLSTEQVLGTAEKFSVSYAGLYDDVDPGSR
ILIDDGLIELEVIEKADGNIRTKVLNSGTVKNKKGVNVPNVSIKLPGITEKDVKDIIFGI
EQKVDFIAASFVRKASDVLEIRELLEEHNAQYIQIVPKIENQEGIDNIDSILEVSDGLMV
ARGDMGVEIPPEEVPLVQKRLIKKCNVLGKPVITATQMLDSMQRNPRPTRAEASDVANAI
FDGTDAIMLSGETAAGQYPVEAVTMMANIAVRVEKSLQYEDMFKKRIKEFTPTITDAISQ
SVAHTALALDVAAIVAPTESGYTAKMISKYRPKSPIVAVTSDEQVGRRLALVWGVQAFMA
EKRAASTDEMLDTAIQTGMDAGLIGLGDTVVITAGVPVAETGTTNLMKIHVVGEEIAKGQ
GIGRKAAKGKVVVAKTAAEAVANVNEGDILVTTSTDKDMIPAIEKAAALVVEEGGLTSHA
AVVGVSIGIPVIVGVNGVTATLKNGQEVTVDAARGIVYNGHAEVL
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaactaaaattgtatgtactataggtcctgctagtgaaagtattgaaaaatta
gagcaattaatcgaagcaggtatgaacgttgctcgtttaaacttctctcatggtagccat
gaagagcacggagctcgtattaaaaacattcgtgaagcttcaaagaaaactggtaaaaca
gttggtatcttacttgatacaaaaggtccagaaatccgtactcacgacttcgtagacgga
caagctgagcttgtaacaggtgcagaagtagttctttctactgagcaagtattaggtact
gcagagaagttctctgtatcttatgctggtctttatgacgatgtagacccaggttctcgt
attctaatcgatgacggtcttatcgaactagaagtaatcgaaaaagctgatggaaacatc
cgtacaaaagttcttaacagcggaactgtaaaaaataaaaaaggtgttaacgtaccaaac
gtaagcattaagcttcctggtatcactgaaaaagacgtaaaagatatcatcttcggtatc
gagcaaaaagttgatttcattgcagcttcattcgtacgtaaagcgtctgacgtattagaa
atccgtgaattattagaagagcataacgctcaatacatccaaatcgtaccaaaaatcgaa
aaccaagaaggtatcgacaacatcgattcaatcttagaagtttctgacggtttaatggta
gctcgtggtgacatgggtgtagaaattccaccagaagaagtaccgttagtacaaaaacgt
ctaattaaaaaatgtaacgtgttaggtaaaccagttattactgcaacacaaatgttagat
tctatgcaacgtaacccacgtccaactcgtgcggaagcaagtgacgtagctaacgcaatc
ttcgatggtacagatgcaatcatgctttcaggtgaaacagctgctggacaatacccagta
gaagcagtaacaatgatggctaacattgcggtacgtgttgaaaaatcattacaatatgaa
gatatgttcaaaaaacgtattaaagagttcactccaacaattacagatgcaattagccaa
tctgttgcacatacagcacttgctcttgatgtagctgcaatcgtagctccaacagaaagt
ggatatactgcgaaaatgatctctaaataccgtccaaaatctccaatcgtagctgtaaca
tctgacgagcaagtaggacgtcgtcttgcacttgtttggggtgtacaagcatttatggct
gagaagcgcgcagcttcaactgacgaaatgttagatacagcaattcaaacaggtatggat
gcaggcctaatcggacttggagatactgtagtgattactgctggtgttccagttgctgaa
actggtacaacaaacttaatgaaaatccacgttgttggtgaagaaattgctaaaggacaa
ggaatcggtcgtaaagctgcaaaaggcaaagtagttgtagcaaaaacagctgctgaagct
gtagcgaacgtaaacgaaggtgatatccttgttacaacaagcactgataaagatatgatt
cctgcaatcgaaaaagctgcagctttagttgtagaagaaggtggcttaacaagccatgca
gctgttgtaggtgtatcaatcggtattcctgttatcgttggtgtaaacggcgtaacagca
actttaaaaaatggccaagaagtaacagttgatgcagcacgcggaattgtttataatgga
catgcggaagtgctataa

DBGET integrated database retrieval system