KEGG   Bacillus thuringiensis serovar chinensis CT-43: CT43_CH0297Help
Entry
CT43_CH0297       CDS       T01838                                 

Gene name
gatB
Definition
(GenBank) aspartyl/glutamyl-tRNA amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
btc  Bacillus thuringiensis serovar chinensis CT-43
Pathway
btc00970  Aminoacyl-tRNA biosynthesis
btc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btc00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CT43_CH0297 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:btc03029]
    CT43_CH0297 (gatB)
Enzymes [BR:btc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     CT43_CH0297 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     CT43_CH0297 (gatB)
Mitochondrial biogenesis [BR:btc03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CT43_CH0297 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey Aconitase_B_N
Motif
Other DBs
NCBI-ProteinID: AEA13990
LinkDB All DBs
Position
342226..343653
Genome map
AA seq 475 aa AA seqDB search
MNLETIIGLEVHVELKTNSKIFSASPTEFGAEPNTQTSVIDLGYPGVLPTLNKEAVNFAM
KAAMALNCEIATETKFDRKNYFYPDNPKAYQISQFDKPIGENGWIEIEVDGKKKRIGITR
LHLEEDAGKSTHTADGSLVDYNRQGMPLIEIVSEPDMRTPEEAYAYLEKLKSIIQYTGVS
DCKMEEGSLRCDANISLRPVGQEKFGTKAELKNLNSFTYVQKGLEHEQVRQEKELLSGGI
IQQETRRYDEATKKTILMRVKEGSDDYRYFPEPDLVELYIDDEWKEAVRASIPELPDARK
ARYVAELGLPAYDAHVLTLTKEMSDFFEATVADGADAKLTSNWLMGEVLAYLNKQQKELK
DVALTPAGLSKMVQLIEKGTISSKIAKKVFNELIEKGGDPEEIVKAKGLVQISDEGTLRK
VVTEILDNNEQSIEDFKNGKDRAIGFLVGQIMKATKGQANPPLVNKILLEEINKR
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgaatttagaaacaattattggtttagaggttcacgttgagttaaaaacaaattcgaaa
attttctctgcgagtccaacagaattcggagcggagccaaatacacaaacaagtgtaatt
gacttaggatacccaggggtacttcctactttaaataaagaagcagttaactttgcaatg
aaagctgcaatggcattaaactgtgaaatcgcaacggaaacgaagtttgaccgtaaaaac
tatttctatccagataacccgaaagcttaccaaatctctcaatttgataagccaattggt
gaaaatggttggattgaaatcgaagtagacggtaaaaagaaacgtatcggtattacacgt
cttcatttagaagaagatgctggtaaatcaacgcatacagctgatggttcattagtagac
tacaaccgtcaaggtatgcctttaatcgagatcgtatctgagccagatatgcgtacgcca
gaagaagcatatgcatacttagagaagttaaaatcaattattcaatacactggtgtatct
gattgtaagatggaagaaggttccttgcgttgtgatgcgaacatttctcttcgtccagtt
ggacaagaaaagttcggtacaaaagcggaactgaaaaacttaaactcattcacttacgta
caaaaaggtcttgagcatgagcaagtgcgccaagaaaaagaattgttatctggtggcatc
atccaacaagaaacacgtcgttatgatgaagcaacgaagaaaacaatcttaatgcgtgtg
aaagaaggatctgacgattaccgttacttcccggagccagacttagttgaactttacatc
gatgatgagtggaaagaagcagttcgagcttctattccagaacttccagatgcacgtaaa
gctcgctacgttgcagaactaggcttaccagcttatgatgcacacgtgttaacattaacg
aaagagatgtctgatttctttgaagcaactgttgcagacggtgctgatgcgaaattaaca
tcgaactggttaatgggtgaagtacttgcatacttaaacaaacaacaaaaagaattaaaa
gacgttgcattaacgcctgctggtttatctaaaatggttcaattaattgaaaaaggtaca
atttcttctaaaatcgcgaagaaagtatttaatgaattaattgaaaaaggtggagaccca
gaagaaatcgttaaagcgaaaggtcttgttcaaatttctgacgagggtacacttcgtaaa
gttgtaacagaaattcttgataataatgagcaatctatcgaagactttaaaaacggtaaa
gaccgtgcaattggcttcttagttggtcaaattatgaaagctacaaaaggacaagcaaat
ccaccgcttgttaacaaaatcttacttgaagagattaataagcgataa

DBGET integrated database retrieval system