KEGG   Bacillus thuringiensis serovar chinensis CT-43: CT43_CH1443Help
Entry
CT43_CH1443       CDS       T01838                                 

Gene name
aroC1
Definition
(GenBank) chorismate synthase
  KO
K01736  chorismate synthase [EC:4.2.3.5]
Organism
btc  Bacillus thuringiensis serovar chinensis CT-43
Pathway
btc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
btc01100  Metabolic pathways
btc01110  Biosynthesis of secondary metabolites
btc01130  Biosynthesis of antibiotics
btc01230  Biosynthesis of amino acids
Module
btc_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:btc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CT43_CH1443 (aroC1)
Enzymes [BR:btc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.5  chorismate synthase
     CT43_CH1443 (aroC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_synt
Motif
Other DBs
NCBI-ProteinID: AEA15129
LinkDB All DBs
Position
1494395..1495567
Genome map
AA seq 390 aa AA seqDB search
MRYITAGESHGPQLTTIIEGVPAGLSLVADDINEELARRQKGYGRGRRMQIETDQVQILS
GVRHGETLGSPIALVVENRDFAHWTKIMGAEPLTEQEEKEIKRKVTKPRPGHADLNGAIK
YGHRDMRNVLERSSARETTVRVAAGAVAKKVLAELGIKVAGHVIEIGGVQAKEVTYSSIE
ELKSITEASPVRCLDDEAGNQMMKAIDDAKANGDSIGGIVEVIVEGMPIGVGSYVHYDRK
LDAKLAAAIMSINAFKGVEIGIGFEAAHRPGSEVHDEILWNEEHGYTRRTNNAGGLEGGM
TTGMPIVVRGVMKPIPTLYKPLQSVDIDTKEPFTASIERSDSCAVPAASVVAEAVVAWEL
ATALIEQFGLDRMELIRENIEKHNEYARGF
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgcgatatattacagctggtgaatctcatggtccgcaacttacaacgattatagaaggt
gttccagcaggattgtctttagtagcggatgatataaacgaagagttagctagaaggcaa
aagggatatgggcgtggtagacgcatgcaaattgaaacggatcaagtgcaaattttaagt
ggtgttagacatggagaaacattaggttcccctattgcactcgttgttgaaaatcgtgat
tttgcccattggacaaaaattatgggggcagagcctttaactgagcaggaagaaaaagag
ataaaaaggaaagtgacaaaaccaaggcctgggcatgctgatttaaatggtgcaattaaa
tatggtcatagagatatgaggaatgtactggaacgttcgtcagcgcgcgaaacgacggtg
cgtgttgctgctggtgcggttgctaaaaaggtgttagcagaacttggtattaaagtggcg
ggccatgtaattgaaattggcggtgtacaagctaaggaggttacgtatagttcaattgaa
gaattaaagagtattacagaagcatctcctgtacgttgcttagatgacgaagctggtaac
caaatgatgaaagcgattgatgatgcgaaagcaaatggtgattcaattggtggaatcgtt
gaagtaattgtggaaggaatgccaattggagtaggtagctacgtgcattatgatcgaaaa
ctggatgcgaaattagcagctgcaattatgagtattaatgcttttaaaggtgtcgagatt
ggaattggttttgaagcagcgcatagaccgggaagtgaagttcatgatgaaattctatgg
aatgaggagcatggatatacaagaagaacaaataatgcaggtggattagaaggcggtatg
acgactggaatgccaattgttgtgcgcggtgtgatgaaaccgatacctacactttataaa
cctcttcaaagtgtagatattgatacgaaagagccttttacagcgagcattgaacgttca
gatagttgtgcagtgccagcagctagtgtcgttgcagaagcggttgtggcttgggaatta
gcaacagctttaatagaacaattcggattagatcgtatggaactaattcgtgaaaatatt
gagaaacataatgaatatgcgaggggattttaa

DBGET integrated database retrieval system