KEGG   Bacillus thuringiensis serovar chinensis CT-43: CT43_CH2023Help
Entry
CT43_CH2023       CDS       T01838                                 

Gene name
dal2
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
btc  Bacillus thuringiensis serovar chinensis CT-43
Pathway
btc00473  D-Alanine metabolism
btc01100  Metabolic pathways
btc01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:btc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CT43_CH2023 (dal2)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    CT43_CH2023 (dal2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:btc01011]
    CT43_CH2023 (dal2)
Enzymes [BR:btc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     CT43_CH2023 (dal2)
Peptidoglycan biosynthesis and degradation proteins [BR:btc01011]
 Precursor biosynthesis
  Racemase
   CT43_CH2023 (dal2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Dimerisation
Motif
Other DBs
NCBI-ProteinID: AEA15707
LinkDB All DBs
Position
2040965..2042140
Genome map
AA seq 391 aa AA seqDB search
MSLKYGRDTIVEIDLNAVKHNVKEFKKHVNDEEIKMMAAVKANGYGHGAVEVAKAAIEAG
INQLAVAFVDEAIELREAGITVPILILGYTPVAAVEDVIQYDVMMTVYRVEDLHGINEIA
NRLQKKVQIQVKIDTGMSRIGLQEEEVKPFLEELNRMEYIEVVGIFTHYSTADEIDKSYT
NMQTSLFEKAVNTAKELGIQIPYIHSSNSAGSMELSNTFQNMVRVGIGVYGMYPSKEVDH
SVVSLQPALSLKSKVAHIKHAKKNRGVSYGNTYVTTGEEWIATVPIGYADGYNRQLSNKG
YALINGVRVPVIGRVCMDQLMLDVSKAMPVQVGDEVVFYGKQGEENITVEEIADMLSTIN
YEVTCMLDRRIPRVYKENDETTAVVNILRKN
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagtttgaaatatggaagagatacaattgtagaaattgacttaaatgctgtaaaacat
aatgtaaaagaatttaaaaaacatgtaaatgatgaagaaattaagatgatggctgctgta
aaagcgaatgggtatggccatggggcagttgaagttgccaaagctgcaattgaagctgga
ataaatcaacttgcagttgcatttgtagatgaagcaatagaattaagagaagcaggaatt
actgtgccgattttaattttaggatacacaccagtagcggctgtagaagatgtaattcaa
tatgacgttatgatgactgtttatagagtagaagatttacatggtataaatgaaattgca
aaccgtcttcaaaagaaagtacaaattcaagtgaaaattgatacaggaatgagtcgtatc
ggtttacaagaagaagaagttaaaccatttttagaagaattaaaccgtatggagtatata
gaagtagtagggatatttacgcattactctacggcagatgaaatcgataaatcatatacg
aatatgcaaacaagtttatttgaaaaagctgttaatacagcgaaagaattaggaattcaa
ataccatatattcatagttcaaatagtgcaggatcaatggaattaagtaacacatttcaa
aatatggtgcgcgttggaataggagtgtacggtatgtatccatcaaaagaggtggatcat
tcagtcgtttctttacagcctgcgttgtcgttaaaatcaaaagtggctcatattaaacat
gcgaagaaaaatcgtggtgtaagttatgggaatacgtatgtaacaactggtgaagaatgg
attgcgactgtaccaattggttatgctgatggttataatcgtcaattatctaataaaggc
tatgcgttaattaacggggttcgagtacctgtaattggccgtgtttgtatggatcagtta
atgttggatgtttcaaaagcgatgccagtacaagtaggagacgaagtagtattctacggt
aaacaaggtgaagaaaatatcacagtagaagaaatagcggatatgttaagtacaataaac
tatgaagttacatgtatgctagatagaagaattccgcgtgtttataaagaaaatgacgaa
acaactgcagttgtaaatatattaagaaaaaactga

DBGET integrated database retrieval system