KEGG   Burkholderia thailandensis MSMB121: BTI_1765Help
Entry
BTI_1765          CDS       T02644                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
btd  Burkholderia thailandensis MSMB121
Pathway
btd00010  Glycolysis / Gluconeogenesis
btd00053  Ascorbate and aldarate metabolism
btd00071  Fatty acid degradation
btd00280  Valine, leucine and isoleucine degradation
btd00310  Lysine degradation
btd00330  Arginine and proline metabolism
btd00340  Histidine metabolism
btd00380  Tryptophan metabolism
btd00410  beta-Alanine metabolism
btd00561  Glycerolipid metabolism
btd00620  Pyruvate metabolism
btd00625  Chloroalkane and chloroalkene degradation
btd00903  Limonene and pinene degradation
btd01100  Metabolic pathways
btd01110  Biosynthesis of secondary metabolites
btd01120  Microbial metabolism in diverse environments
btd01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:btd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BTI_1765
   00053 Ascorbate and aldarate metabolism
    BTI_1765
   00620 Pyruvate metabolism
    BTI_1765
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BTI_1765
   00561 Glycerolipid metabolism
    BTI_1765
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BTI_1765
   00310 Lysine degradation
    BTI_1765
   00330 Arginine and proline metabolism
    BTI_1765
   00340 Histidine metabolism
    BTI_1765
   00380 Tryptophan metabolism
    BTI_1765
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BTI_1765
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BTI_1765
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BTI_1765
Enzymes [BR:btd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     BTI_1765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: AGK49255
LinkDB All DBs
Position
1:1908030..1909466
Genome map
AA seq 478 aa AA seqDB search
MKTCEQFYIGGAWRPSAGKGTIDVIDSGTEAVIGRIPEGAAEDAKAAVAAARAAFDDWAA
TPPAERARYLHRITDNLKARSEELAQSITGEVGMPIKLSRAIQVGGPIYNWGAYAKLAET
FAFEEQVGNSLVVREPVGVVAAITPWNYPLNQITLKVAAALAAGCTVALKPSEVAPLNAF
ILAEAIHDAGLPAGVFNLVCGYGPVVGEALASDPDVDMVSFTGSTRAGKRVAELAAAGVK
RVALELGGKSASVILDDADFAAAVKGTVSACYLNAGQTCSAHTRMLVPESRYEEARDLAK
AAAQTYVAGDPRDDATRLGALASSVQQKRVQDYIRRGIDEGAELVTGGLGMPEGIARGFF
VKPTVFGRVEPGATIAQEEIFGPVLSIITYRDEDDAVRIANDSPYGLGGAVWSGSDERAM
RVARRIRTGQVDINGGAWNMAAPFGGFKQSGIGRENGTYGLDEYLEYKSMQLRPKKGA
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacctgcgaacagttctacatcggcggcgcgtggcgcccgagcgcgggcaagggc
acgatcgacgtgatcgactccggcaccgaggccgtgatcggccgcattcccgaaggcgcc
gccgaagacgcgaaagcggccgtcgccgccgcgcgcgcggcgttcgacgactgggccgcg
acgccgcccgccgagcgcgcccgctatctgcacaggatcaccgacaacctgaaggcgcgc
agcgaggaactcgcgcaatcgatcacgggcgaagtcggcatgccgatcaagctgtcgcgc
gcgatccaggtcggaggcccgatctacaactggggtgcgtatgcgaagctcgccgagacc
ttcgcgttcgaggaacaggtcggcaattcgctcgtcgtgcgcgagcccgtaggcgtcgtc
gcggcgatcacgccgtggaactacccgctcaaccagatcacgctgaaggtcgccgccgcg
ctcgcggccggctgcacggtcgcgctgaagccgtccgaagtcgcgccgctcaatgcgttc
atcctcgccgaagcgattcacgacgcggggctgcccgccggcgtgttcaatctcgtgtgc
ggctacgggcccgtcgtcggcgaggcgctcgcgagcgaccccgatgtcgacatggtgtcg
ttcaccggctcgacgcgcgcgggcaagcgcgtcgccgagctcgccgcggccggcgtgaag
cgcgtcgcgctcgagctgggcggcaagtcggcgtcggtgattctcgacgacgccgacttc
gcggccgcggtgaagggcacggtgtccgcgtgctatctgaatgcaggccagacgtgctcc
gcgcacacgcggatgctcgtgccggaatcgcgctacgaagaagcgcgcgacctcgcgaag
gccgcggcgcaaacctatgtcgcgggcgatccgcgcgacgatgcgacgcggctcggcgcg
ctggcgtcgtcagtccagcaaaagcgcgtgcaggattatatccggcgcggcatcgacgaa
ggcgcggagctcgtcacgggcggcctcggcatgccggaaggcattgcgcgcggcttcttc
gtgaagccgaccgtgttcgggcgcgtggagcccggcgcgacgatcgcgcaggaggaaatc
ttcggcccggtgctgtcgatcatcacgtatcgcgacgaagacgatgcagtgcggatcgcg
aacgattcgccgtacggcctcggcggcgcggtgtggtcgggcagcgacgagcgcgcgatg
cgcgtcgcgcgccgcattcgcacggggcaggtcgacatcaacggcggcgcctggaacatg
gccgcgccgttcggcggtttcaagcagtcggggatcggccgcgagaacggcacgtatggg
ctcgacgaatatctcgaatacaaatcgatgcaactgcggccgaagaagggcgcgtaa

DBGET integrated database retrieval system