KEGG   Burkholderia thailandensis MSMB121: BTI_195Help
Entry
BTI_195           CDS       T02644                                 

Gene name
acoD
Definition
(GenBank) acetaldehyde dehydrogenase 2
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
btd  Burkholderia thailandensis MSMB121
Pathway
btd00010  Glycolysis / Gluconeogenesis
btd00620  Pyruvate metabolism
btd01100  Metabolic pathways
btd01110  Biosynthesis of secondary metabolites
btd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:btd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BTI_195 (acoD)
   00620 Pyruvate metabolism
    BTI_195 (acoD)
Enzymes [BR:btd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     BTI_195 (acoD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AGK47759
LinkDB All DBs
Position
1:complement(225387..226907)
Genome map
AA seq 506 aa AA seqDB search
MNHADMQHLNIEFPYRKQYGNFIGGEWVAPVGGEYFDNVSPVTGRPFTAIPRSRAADVEL
ALDAAHAAKAGWAATGAAERANVLLKIADRMEANLTRLAVAETIDNGKPLRETTAADVPL
AIDHFRYFAGCIRAQEGSIADIGDDMVAYHFHEPLGVVGQIIPWNFPLLMAAWKLAPALA
AGNCVVLKPAEQTPASILVFAELIQDLLPPGVLNIVNGFGLEAGKPLASSKRIAKIAFTG
ETSTGRLIMQYASENLIPVTLELGGKSPNIFFADVMDRDDSYFDKALEGFAMFALNQGEV
CTCPSRALVEESIYDRFIERALKRVEAIKQGHPLDAQTMIGAQASAEQLEKILSYIDIGR
GEGAQCLTGGERNVLGGELAEGYYVKPTVFRGHNKMRIFQEEIFGPVLAVTTFQTEEEAL
EIANDTLYGLGAGVWTRDGNRAYRVGRGIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRET
HKMMLDHYQQTKNLLVSYGEKPLGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaatcacgcggacatgcaacatctgaacatcgaattcccgtaccgcaagcagtacggg
aatttcatcggcggcgaatgggtcgccccggtcggcggcgagtatttcgacaacgtctcg
cccgtcaccggccggccgttcaccgcgatccctcgctcgcgcgcagccgacgtcgagctc
gcgctcgacgccgcgcacgcggcgaaggcgggctgggccgcgacgggcgcggccgagcgc
gcgaacgtgctgctgaagatcgccgaccggatggaggcgaacctcacgcgcctcgctgtc
gccgagacgatcgacaacggcaagccgctgcgcgagaccaccgcggccgacgtgccgctc
gcgatcgaccacttccgctacttcgcgggctgcatccgcgcgcaggaaggctcgatcgcc
gacatcggcgacgacatggtcgcctatcacttccacgagccgctcggcgtcgtcggccag
atcatcccgtggaacttcccgttgctgatggccgcgtggaagctcgcgcccgcgctcgcg
gccggcaactgcgtcgtgctcaagcccgccgagcagacgcccgcgtcgatcctcgtgttc
gccgagctgatccaggatctgctgccacccggcgtgctcaacatcgtcaacggcttcggg
ctcgaggcgggcaagccgctcgcgtcgagcaagcggatcgcgaagatcgcgttcacgggc
gagacgtcgacgggccgcctcatcatgcagtacgcaagcgagaacctgatccccgtcacg
ctcgagctcggcggcaagagcccgaacatcttcttcgccgacgtgatggaccgcgacgac
agctacttcgacaaggcgctcgaaggcttcgcgatgttcgcgctgaaccagggcgaggtc
tgcacgtgcccgtcgcgcgcgctcgtcgaggagagcatctacgatcgcttcatcgagcgt
gcgttgaagcgcgtcgaggcgatcaagcagggccatccgctcgacgcgcagacgatgatc
ggcgcgcaggcgtcggccgagcagctcgagaagatcctgtcgtacatcgacatcggccgc
ggcgaaggcgcgcagtgcctgacgggcggcgagcgcaacgtgctcggcggcgagctcgcc
gaaggctattacgtgaagccgaccgtgttccgcggccacaacaagatgcgcatcttccag
gaagagatcttcgggccggtgctcgcggtgacgacgttccagaccgaggaggaagcgctc
gagatcgcgaacgacacgctgtacggcctcggcgcgggcgtctggacgcgcgacggcaac
cgcgcataccgcgtcggccgcggcatccaggcgggccgcgtgtggacgaactgctatcac
gcgtatccggcgcacgcggcgttcggcggctacaagcagtcgggcatcggccgcgagacg
cacaagatgatgctcgaccactaccagcagacgaaaaacctgctcgtcagctacggcgag
aagccgctcgggttcttctga

DBGET integrated database retrieval system