KEGG   Burkholderia thailandensis MSMB121: BTI_2307Help
Entry
BTI_2307          CDS       T02644                                 

Gene name
sucA
Definition
(GenBank) oxoglutarate dehydrogenase (succinyl-transferring), E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
btd  Burkholderia thailandensis MSMB121
Pathway
btd00020  Citrate cycle (TCA cycle)
btd00310  Lysine degradation
btd00380  Tryptophan metabolism
btd01100  Metabolic pathways
btd01110  Biosynthesis of secondary metabolites
btd01120  Microbial metabolism in diverse environments
btd01130  Biosynthesis of antibiotics
btd01200  Carbon metabolism
Module
btd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
btd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:btd00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BTI_2307 (sucA)
  Amino acid metabolism
   00310 Lysine degradation
    BTI_2307 (sucA)
   00380 Tryptophan metabolism
    BTI_2307 (sucA)
Enzymes [BR:btd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     BTI_2307 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr OxoGdeHyase_C E1_dh 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: AGK48303
LinkDB All DBs
Position
1:complement(2525257..2528121)
Genome map
AA seq 954 aa AA seqDB search
MSDVMKQFQLNSYLFGGNASYVEELYEAYLDNPASVPDNWREYFDALQNVPATDGSSASD
VAHNPIVESFAQRAKANAFIPRESGGNLATARKQVHVQSLISAYRFLGSQWANLDPLKRR
ERPAIPELEPAFYDFSEADLDQTFSASNLYFGFEQASLRDIVKGLRDTYCGTIGVEFMYI
SDPEQKRWWQERLESSHATPNFSADKKKHILNRLTAAEGLERYLHTKYVGQKRFSLEGGE
SFIASMDEVVQRAGSKGVQEIVIGMAHRGRLNVLVNTLGKMPADLFAEFEGKHVDDLPAG
DVKYHKGFSSDIATEGGPVHLSLAFNPSHLEIVNPVVEGSAKARMDRRGDADGLQVLPVQ
IHGDAAFAGQGVVMETLNLAQTRGYGTHGTLHIVINNQIGFTTSDPRDARSTLYCTDVVK
MIEAPVLHVNGDDPEAVVLATQIAIDYRMQFHKDVVIDIVCFRKLGHNEQDTPAVTQPLM
YKKIAQHPGTRALYAEKLAQQGVISAEDADGFVKAYRKAMDDGHHTVDPVLSNYKSKYAV
DWMPFLNRKWTDAADTAVPLAELKRLGERITTVPQNFKVHPLVERVINDRRNMARGDQPL
DWGMGEHLAYASLVASGYAVRLTGQDSGRGTFTHRHAVLHDQNRERWNDGTYVPLQNISE
GQAKFNVIDSVLSEEAVLGFEYGYSTAEPNTLVLWEAQFGDFANGAQVVIDQFISSGEVK
WGRVSGLTMLLPHGYEGQGPEHSSARIERYLQLCAEHNMQVVQPTTPAQIFHLLRRQMIR
LFRKPLIVATPKSLLRHKEAVSDLSELAKGSFQPVLGEVDGGIDAKKVKRVIACSGRVYY
DLVAHRREAKANDAAIVRIEQLYPFAHKQFEAEMKKYENATEVVWVQDEPQNQGPWFYVE
HHLKEGMKEGQKLAYSGRPASASPAVGYYAKHYEQQKALIEGAFGRLKSASVAK
NT seq 2865 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatgtaatgaagcaattccagctgaactcgtatctgttcggcggcaatgcttcg
tatgttgaagaactgtacgaagcctatttggataacccggcgtcggtgccggacaactgg
cgcgaatatttcgacgcgctgcaaaacgtccccgcaaccgatggttcgagcgcgagcgac
gtggcccacaacccgatcgtagagtcgttcgcccagcgcgcgaaagccaacgctttcatc
ccgcgcgaaagcggcggcaacctcgccaccgcccgcaagcaagtccacgttcagtccctc
atcagcgcgtatcgcttcctcggctcgcaatgggccaacctcgatcccctgaagcgccgc
gaacgccccgcgattcccgagctggaacccgcgttctacgatttctccgaagccgacctc
gaccagacgttcagcgcgagcaacctgtatttcgggttcgagcaggcgtcgctgcgcgac
atcgtcaaggggctgcgcgacacgtattgcggcacgatcggcgtcgaattcatgtacatc
agcgatcccgagcagaagcgctggtggcaggagcgcctcgagtcgagccatgcgacgccg
aacttctcggccgacaagaagaagcacatcctgaaccgcctgacggccgccgaaggcctc
gagcgctatctgcacacgaagtacgtcggccagaagcgcttctcgctcgaaggcggcgag
agcttcatcgcgtcgatggacgaagtcgtccagcgcgcgggctcgaagggcgtgcaggaa
atcgtcatcggcatggcgcaccgcggccgtctgaacgtgctcgtgaacacgctcggcaag
atgccggcggatctcttcgccgaattcgagggcaagcacgtcgacgacctgccggcgggc
gacgtgaagtaccacaagggcttctcgtccgacatcgcgacggaaggcggcccggtccac
ctgtcgctcgcgttcaacccgtcgcacctcgaaatcgtgaacccggtggtcgagggctcc
gcgaaggcgcggatggaccgccgcggcgacgccgacggcctgcaggtgctgcccgtgcag
atccacggcgacgcggcgttcgccggccagggcgtcgtgatggaaacgctgaacctcgcg
cagacgcgcggctacggcacgcacggcacgctgcacatcgtcatcaacaaccagatcggc
ttcacgacgtcggacccgcgcgacgcgcgctcgacgctgtactgcacggacgtcgtcaag
atgatcgaggcgccggtgctgcacgtgaacggcgacgatccggaagcggtcgtgctcgcg
acgcagatcgcgatcgactaccggatgcagttccacaaggatgtcgtgatcgacatcgtc
tgcttccgcaagctcgggcacaacgagcaggacacgccggccgtcacgcagccgctgatg
tacaagaagatcgctcagcacccaggcacccgcgcgctgtacgcggagaagctcgcgcag
cagggcgtgatcagcgccgaggacgccgacggcttcgtgaaggcgtaccgcaaggcgatg
gacgacggccaccacacggtcgatccggtgctgtcgaactacaagagcaagtacgcggtc
gactggatgccgttcctgaaccgcaagtggacggacgccgccgacaccgcggtgccgctc
gccgagctgaagcgcctcggcgaacgcatcacgacggtgccgcaaaacttcaaggtccac
ccgctcgtcgagcgcgtgatcaacgaccgccgcaacatggcgcgcggcgatcagcccctc
gactggggcatgggcgagcacctcgcgtacgcatcgctcgtcgcgtccggctacgccgtg
cgcctgacgggccaggattcgggccgcggcacgttcacgcaccgtcatgcggtgctgcac
gaccagaaccgcgagcgctggaacgacggcacgtacgtgccgctgcagaacatctcggaa
ggccaggcgaagttcaacgtgatcgactcggtgctgtccgaagaggcggtgctcggcttc
gaatacggctactcgaccgccgagccgaacacgctcgtgctgtgggaagcgcagttcggc
gatttcgcgaacggcgcgcaggtggtgatcgaccagttcatctcgtcgggcgaagtgaag
tggggccgcgtgtcgggcctcacgatgctgctgccgcacggctatgaaggccagggtccg
gagcactcgtcggcgcgcatcgagcgctatctgcagttgtgcgcggagcacaacatgcag
gtcgtccagccgacgacgcccgcgcagattttccacctgctgcgccgccagatgatccgc
ctgttccgcaagccgctcatcgtcgcgacgccgaagtcgctgctgcgccacaaggaagct
gtgtcggatctgtcggagctcgcgaagggttcgttccagccggtgctcggcgaagtcgac
ggcggcatcgacgcgaagaaggtcaagcgcgtgatcgcgtgctcgggccgcgtgtactac
gacctcgtcgcgcatcgccgtgaagcgaaggcgaacgacgccgcgatcgtgcggatcgag
cagctctatccgttcgcgcacaagcagttcgaagcggaaatgaagaagtacgagaacgcg
acggaagtggtctgggtgcaggacgagccgcaaaatcaggggccgtggttctatgtcgaa
caccacctgaaggaaggcatgaaggaagggcagaagctcgcgtacagcggccgcccggct
tccgcctcgccggccgtcggctattacgcgaagcactacgagcagcagaaggccctcatc
gaaggcgcattcggccgcttgaagagcgcatcggtcgcgaaataa

DBGET integrated database retrieval system